KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663303Help
Entry
104663303         CDS       T03989                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104663303 (DOCK8)
Membrane trafficking [BR:rro04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    104663303 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 104663303
NCBI-ProteinID: XP_030776019
Position
16
AA seq 2098 aa AA seqDB search
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPR
HLNVLCDVSGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVDASSLARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYLVIKESDGGKSKDKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLERE
VTDVDSVVGRSSVGERRTLAQSRRLSERALSLEENGLGSNFKTSTLSVSSFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRP
HKEILEFPTREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDACSAMPV
IFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGA
SVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMALEHELKLSIICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKD
QHGRNCLLASYVHYVFRLPELQRDVPKSGAPTALPDPRYHTYGRTSAAAVSSKLLQARVM
SSSNPDLAGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGNSDVPSSTTAPRPASKKHFH
EELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHNMDKQDSFRRTRFSDRFMDDIT
TIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIRHYCNQLSA
KLNNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAPTSPCPSISSQNSSSCSSFQDQ
KIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAIHSLLSSHDLDPR
CVKPEVKVKIAALYLPLVGIILDALPQLCDFTVADTRRYRTSGSDEEQEGAGAINQNVAL
AIAGNHFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLPS
MQLNRILDLLFICVLCFEYKGKQNSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRR
RAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEAHLIILDMQ
ENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSSTYLTHCFATLRALITKFGDLLFEEEV
EQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGR
APDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDPE
MLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLED
HSYLPVGSVSFQNISSNVLEESVVSDDTLSPDEDGVCAGQYFTESGLVGLLEQAAELFST
GGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFG
SKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKA
YIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTT
MHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDPKMLQMVLQGSV
GATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQRE
YQQELKKNYSKLKENLRPMIERKIPELYKPIFRIESQKRDSFHRSSFRKCETQLSQGS
NT seq 6297 nt NT seq  +upstreamnt  +downstreamnt
atggccactctgcccagcgcagagcgccgcgcgttcgcgctcaagatcaacaggtattct
tcagcggaaataaggaaacagtttactctcccaccaaaccttggccagtaccatcgacag
agcataagtacctctggcttcccctctcttcaactacctcagttttatgaccctgtggag
ccggtggactttgaaggacttctgatgacacacctgaacagtttggatgtgcagcttgcc
caggagctcggggacttcactgatgacgacttggatgtggtgttcactccaaaggaatgt
aggactttgcagccctctttaccggaggaaggggttgaactggaccctcatgtcagggac
tgtgttcagacctacatccgggagtggctaattgtgaaccgaaagaaccaaggaagtcca
gaaatttgtggctttaaaaagactggatctcgaaaagattttcacaagacacttccaaaa
cagacgtttgagtcggaaaccttggagtgcagtgaacccgctgctcaggcaggcccccgc
cacttaaacgtgctctgcgatgtgtctgggaaaggccccgtcactgcctgtgactttgac
ctccgtagcctgcagcctgacaagcggctagaaaacctcctgcagcaagtgagtgccgag
gactttgagaagcagaacgaggaggcccggaggaccaatcggcaggccgagctctttgcc
ctttacccgtcagtggacgaggaggatgctgtggaaatacgtccagtaccagaatgtccc
aaggaacacctgggcaacagaatattggtcaagttgctgaccttgaagtttgagattgaa
attgagcctctgtttgccagcattgccctctacgatgttaaagaaaggaaaaagatctca
gaaaattttcactgtgacctgaactctgaccagttcaaaggatttctgcgagctcacaca
ccttcggtggacgcatcaagcctggcgagatctgcagtcttctccgtcacctacccgtcc
tcagacatctacctggtagtcaagattgaaaaagtcctgcagcagggagagattggagac
tgtgcagagccctacctggttatcaaagaaagtgatggtggaaagagtaaagacaagatt
gaaaaactaaaactccaagctgaatccttctgccagcgtttggggaaataccggatgccc
tttgcctgggcacccattagcttatcaagcttcttcaatgtctccacccttgagagggag
gtaactgatgtggactccgtggttggaagaagctcagtgggtgaacggaggacattggcc
caatctagaaggctttctgaaagagccctctccttggaggaaaatgggcttggatccaac
ttcaaaacctccaccctgagcgttagcagctttttcaagcaggaaggagatcgccttagt
gatgaagacttattcaagtttttagctgactacaaaagatcttcgtccttacagagacga
gtcaagtcaattccaggcttgctcagactggagatttctacagctccagagatcatcaat
tgctgtctgactcctgaaatgctgcccgtgaaaccctttcctgaaaaccggacacgcccg
cacaaagagattttggaatttccaacacgagaagtatatgtccctcatacagtgtacaga
aatcttctctatgtctacccacagaggctgaactttgttaacaaactagcatcagcccgg
aacattacaataaagatccagtttatgtgtggagaagatgcttgcagcgcgatgccggtc
atctttggaaagtccagtgggcctgaatttctacaggaagtgtacacagccgttacatac
cataataagtctcctgacttttatgaagaagtgaaaattaagctccccgctaagctcaca
gtaaatcaccacctcctgttcaccttttaccatatcagctgtcagcagaagcaaggagcc
tccgtggaaactctcctgggatattcatggctgccaattctcttaaatgaacgtcttcaa
actggatcctactgtctcccagttgccttggaaaaattgccacccaactactccatgcat
tctgctgagaaagtccctttacagaatcctcccattaagtgggctgaaggacataaggga
gtatttaatattgaagtgcaagctgtttcttctgtgcacacccaggacaaccacctagag
aagttcttcaccctctgccattccctggagagccaggtgaccttccccatccgcgtgctg
gatcagaagatcagcgagatggcgctggagcatgagctaaagctcagcatcatctgcctg
aactcctcccgcctggagccgctcgtgctcttcctgcacctggtgctggacaagctcttc
cagctgtctgtgcagcccatggtcatcgctggccagacagccaacttctcccagtttgcc
ttcgagtctgtggtggccatcgccaacagtctgcacaacagcaaggacctgagcaaggac
cagcatgggaggaactgcctgctggcttcctatgtgcactacgtcttccgcctgccagag
ctgcaaagggacgtgcccaagtcaggcgctcccactgccctccccgaccctcgctaccac
acctatggacgcacatcagctgctgctgtgagttcaaagctgctgcaggcccgggtgatg
agcagcagtaacccagaccttgcagggacacactccgcagcagacgaggaagtgaagaac
atcatgtcttcaaagatcgccgatcgcaactgcagccgaatgtcttactattgctctggc
aatagtgatgttccaagttcaactacagccccaaggccagccagcaaaaagcatttccat
gaggagcttgccctccagatggtggtcagcactggaatggtgagagaaacagtcttcaag
tatgcctggttcttctttgagcttctggtgaaaagcatggcccagcatgtacataacatg
gacaaacaggacagttttcggaggactcgtttttctgaccgtttcatggacgacataact
actattgttaatgtggtcacctcggaaattgcagcccttttagtaaaaccacagaaggaa
aatgaacaggcggaaaagatgaacatcagcctggctttcttcttgtatgaccttctctcc
ctcatggatcggggctttgtgtttaacctcatcagacattattgcaaccagctgtcagcc
aagctcaataaccttccaacgctcatttccatgaggctggagttcctgagaatcctctgt
agccatgaacattacctcaatctgaaccttttttttatgaatgctgatactgctccaaca
tctccttgtccttccatatcttcccagaactcaagctcctgctccagtttccaggaccag
aagatcgccagcatgtttgatctgacttctgagtaccgccagcagcacttcctcaccggg
ctcctcttcacagaactggctgctgccctggatgccgaaggggaaggaatcagcaaagta
caaaggaaagctgtcagtgccatccacagcctgctaagttctcatgacctggacccacgc
tgtgtcaaaccagaggtgaaggtcaaaatcgctgccctttacctgcctttagttggcatc
attttggatgctttaccacagctctgtgactttacagttgcagatactcgcagataccgc
accagtggctcggatgaagaacaagaaggagctggtgccattaaccagaatgtggctctg
gccatagcagggaatcatttcaatttgaaaacaagtggaatagtgctgtcttccttgccc
tataagcagtacaacatgctgaacgcggacactactcgcaacctcatgatctgcttcctc
tggatcatgaaaaatgctgatcagagcctcattaggaagtggattgctgacctgccatca
atgcagctcaacaggattttagacctacttttcatctgtgtcttatgttttgagtataag
ggaaaacagaattctgacaaagtcagtacccaagtcctgcagaagtcaagggatgtcaag
gcccggctagaagaggctttgctccgtggagaaggggccagaggggagatgatgcgccga
cgggctccagggaacgaccgatttccaggcctaaatgaaaatttgagatggaagaaagag
cagacacattggcggcaagctaatgagaagctagataaaacaaaggcagagttagatcaa
gaagccttgatcagtggcaacctggctacagaagcacatttaatcatcctggatatgcag
gaaaacattatccaggcgagctcggctctggactgtaaagacagcctgctgggaggtgtt
ctgagggtgctggtgaattctctgaactgtgatcagagttccacctacctgactcactgc
tttgcaacactccgtgctctcatcaccaagtttggagacttactcttcgaagaggaggtg
gaacagtgtttcgacctgtgtcaccaagtcctgcaccactgcagcagcagtatggatgtc
acccggagccaagcctgtgccaccctttacctcctcatgaggttcagttttggagccacc
agtaactttgcaagagtaaagatgcaagtaaccatgtcgctggcatctttggtgggcaga
gcaccagactttaatgaagagcacctgagaagatccctgaggacaattttggcctattca
gaagaggacacggccatgcagatgactccttttcccacccaggtggaggaacttctctgt
aatctgaatagcatcttatatgacacggtgaaaatgagggagtttcaggaagatcctgag
atgcttatggatctcatgtacagaattgccaagagttaccaggcatctcctgatctgcgg
ctgacctggctccagaacatggcagagaaacacaccaagaagaaatgctacacagaggcc
gccatgtgcctggtgcacgctgctgcgttagtagctgagtatttgagcatgctggaggac
cacagctacctgcctgtgggcagtgtcagcttccagaatatttcttccaatgtgctggag
gagtctgtggtctctgatgacaccctgtcacctgacgaggatggggtgtgcgcaggccag
tacttcaccgagagtggcctggtgggcctcctggagcaggctgcagagctcttcagcacg
ggaggcttatatgagacagttaacgaggtctacaagctggtcatccccatcctagaagcg
catcgagaattccggaagctgacactcactcacagcaagctgcagagggcctttgacagc
attgtgaacaaggatcataagagaatgtttggaacctacttccgagttggtttctttgga
tccaaatttggggatttggatgaacaagaatttgtttacaaagagcctgcaattaccaag
cttcctgagatctcacatagactagaggcattttatggtcaatgttttggtgcagaattt
gtggaagtgattaaagactccactcctgtggacaaaaccaagttggatcctaacaaggcc
tacatacagatcacttttgtggagccctactttgatgagtatgagatgaaagacagggtc
acatactttgagaagaatttcaacctccggaggttcatgtacaccaccccgttcaccctg
gaggggcggcctcggggagagctgcatgagcagtacagaaggaacacagtcttgaccact
atgcacgccttcccctacatcaagaccaggatcagcgtcatccagaaggaggagtttgtt
ttgacaccgattgaagttgccattgaagacatgaagaagaagacactgcagttagcggtt
gccattaaccaggagccccctgatccaaagatgcttcagatggtgctgcaaggctctgtg
ggagctactgtaaatcagggaccactggaagtagcccaagtgttcttggctgaaattcct
gctgatccaaaactctatcgacatcacaacaagttgaggttatgctttaaggaattcatc
atgagatgtggtgaagccgtagagaaaaacaagcgtctcatcacggcagaccagagggaa
tatcagcaggaactgaaaaagaactatagcaagctaaaagagaacctcaggccaatgatc
gagcggaaaattccagaactgtacaagccaatattcagaattgagagtcaaaagagggac
tccttccacaggtctagtttcaggaaatgtgaaacccagttgtcacagggcagctaa

DBGET integrated database retrieval system