KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663522Help
Entry
104663522         CDS       T03989                                 

Gene name
NPR1
Definition
(RefSeq) atrial natriuretic peptide receptor 1 isoform X1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04270  Vascular smooth muscle contraction
rro04714  Thermogenesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104663522 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104663522 (NPR1)
   04022 cGMP-PKG signaling pathway
    104663522 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104663522 (NPR1)
   04921 Oxytocin signaling pathway
    104663522 (NPR1)
   04924 Renin secretion
    104663522 (NPR1)
   04925 Aldosterone synthesis and secretion
    104663522 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104663522 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    104663522 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104663522 (NPR1)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104663522 (NPR1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   104663522 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA CHASE6_C
Motif
Other DBs
NCBI-GeneID: 104663522
NCBI-ProteinID: XP_010363059
Position
8
AA seq 1061 aa AA seqDB search
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALARVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAAFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEFALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKEPDNPEYLEFLKQLKHLAREQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPETGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLSILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTLYAKKLWTAPELLRMASPPVRGSQAG
DIYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNREHSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccccggcgccccgccggctcccgcctgcgcctgctcctgctcctgctgctg
ccgccgctgctgctgctgctccggggcagccacgcgggcaacctgacggtagccgtggta
ctgccgctggccaatacctcgtacccatggtcttgggcgcgcgtgggacccgccgtggag
ctggccctggcccgggtgaaggcgcgccccgacttgctgccgggctggacggtccgcaca
gtgctgggcagcagcgagaacgcgctgggcgtctgctctgacaccgcagcgcccctggcc
gcggtggacctcaagtgggagcacaaccccgcggcgttcctgggccccggctgcgtgtac
gccgccgccccggtggggcgcttcaccgcgcactggcgggtcccgctgctgaccgccggc
gccccggcgctgggcttcggtgtcaaggacgagtttgcgctgaccacccgcgcggggccc
agctacgccaagctgggggacttcgtggcggcgctgcaccgacggctgggctgggagcgc
caagcgctcatgctctacgcttaccggccgggtgacgaagaacactgcttcttccttgtg
gaggggttgttcatgcgggtccgcgaccgcctcaatattacggtggaccacctggagttc
gccgaggacgacctcagccactacaccaggctgctgcggaccatgccgcgcaaaggccga
gttatctacatctgcagctcccctgacgccttcagaaccctgatgctcctggccttggaa
gctggcttgtgtggggaggactacgttttcttccacctggatatctttggacaaagcctg
caaggtggacagggccctgctccccgcaggccctgggagagaggggatggacaggatgtc
agtgcccgccaggcctttcaagctgccaaaatcattacatataaagagccagataatccc
gagtacttggaattcctgaagcagctaaaacacctggctcgtgagcagttcaacttcacc
atggaggatggcctggtgaacaccatcccagcatccttccacgatgggctcctgctctat
atccaggcagtgacggagactctggcacatgggggaactgttactgatggggagaacatc
actcagcggatgtggaaccgaagctttcaaggtgtgacaggatacctgaaaattgatagc
agtggcgatcgggaaacagacttctccctctgggatatggatcccgagactggtgccttc
agggttgtactgaactacaatgggacttcccaagagctggtggctgtgtcggggcgcaaa
ctgaactggcccctggggtaccctcctcctgacatccccaaatgtggctttgacaacgaa
gacccagcatgcaaccaagatcacctttctaccctggaggtgctggctttggtgggcagc
ctctccctgctcagcattctgattgtctccttcttcatatacaggaagatgcagctggag
aaggaactggcctcggagctgtggcgggtgcgctgggaggacgttgagcccagtagcctt
gagaggcacctgcggagtgcgggcagccggctgaccctgagcgggagaggctccaattac
ggttccctgctaaccacagagggccagttccaagtctttgccaagacagcatattataag
ggcaacctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacacgaaaagtc
ctgtttgaactgaagcatatgcgggatgtgcagaatgaacacctgaccaggtttgtggga
gcctgcaccgacccccccaatatctgcatcctcacagagtactgtccccgtgggagcctg
caggacattctggagaatgagagcatcaccctggactggatgttccggtactcgctcacc
aatgacattgtcaagggcatgctgtttctacacaatggggctatctgctcccatgggaac
ctcaagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcaccgactatggg
ctggagagcttcagagacctggacccagagcaaggacacaccctttatgccaaaaagctg
tggacggcccctgagctcctgcgaatggcttcgccccctgtgaggggctcccaggctggt
gacatatacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccat
gtggaaggtttggacctcagccccaaagagatcatcgagcgggtgactcggggtgagcag
ccccccttccggccctccctggccctgcagagtcacctggaggagttgggactgctgatg
cagcggtgctgggctgaggacccacaggagaggccaccattccagcagatccgcctgacg
ttgcgcaagtttaacagggagcacagcagcaacatcctggacaacttgctgtcccgcatg
gagcagtatgcaaacaatctggaggaactggtggaggagcggacccaggcgtacctggag
gagaagcgcaaggctgaggccctgctctaccagatcctgcctcactcagtggctgagcag
ctgaagcgtggggagacagtgcaggccgaagcctttgacagcgttaccatctacttcagt
gacattgtgggtttcacagcgctgtcagcggagagcacgcccatgcaggtggtgaccctg
ctcaatgacctgtacacttgctttgatgctgtcatagataactttgatgtatacaaggtg
gagacaattggtgatgcctacatggtggtgtcggggctccctgtgcggaacgggcggctg
cacgcctgcgaggtagcccgcatggccctggctctgttggatgctgtgcgctccttccga
atacgccaccggccccaggagcagctgcgcttgcgcattggcatccacacaggacccgtg
tgtgctggagtggtgggactgaagatgccccgttactgtctctttggagatacagtcaac
acagcctcaagaatggagtctaatggggaagccctgaagatccacttgtcttctgagacc
aaggctgtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatg
aagggcaaaggcaaggttcggacctactggctcctgggggagcgggggagtagcacccga
ggctga

DBGET integrated database retrieval system