KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665120Help
Entry
104665120         CDS       T03989                                 

Gene name
PLK2
Definition
(RefSeq) polo like kinase 2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104665120 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104665120 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104665120 (PLK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     104665120 (PLK2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   104665120 (PLK2)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104665120 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     104665120 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    104665120 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like G_path_suppress
Motif
Other DBs
NCBI-GeneID: 104665120
NCBI-ProteinID: XP_010365129
UniProt: A0A2K6P7V5
Position
Un
AA seq 685 aa AA seqDB search
MELLRTITYQPAASTKMCEQALGKGCGGDSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSLELKNRMEYALNMLLQRCN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagcttttgcggactatcacctaccagccagccgccagcaccaaaatgtgcgagcag
gcgctgggcaagggttgcggaggggactcgaagaagaagcggccgccgcagccccccgag
gaatcgcagccacctcagtcccaggcgcaggtgcccccggcggccccgcaccaccatcac
caccattcgcactcggggcccgagatctcgcggattatcgtcgaccccacgacggggaag
cgctactgccgaggcaaagtgctgggaaagggtggctttgcaaaatgttacgagatgaca
gatttgacaaataacaaagtctacgccgcaaaaattattcctcacagcagagtagctaaa
cctcatcaaagggaaaagattgacaaagaaatagagcttcacagaattcttcatcataag
catgtagtgcagttttaccactactttgaggataaagaaaacatttacattctcttggaa
tactgcagtagaaggtcaatggctcatattttgaaagcaagaaaggtgttgacagagcca
gaagttcgatactacctcaggcagattgtgtctggactgaaataccttcatgaacaagaa
atcttgcacagagatctcaaactagggaacttttttattaatgaagccatggaactaaaa
gttggggacttcggtttggcagccaggctagaacccttggaacacagaaggagaacgata
tgtggtaccccaaactatctctctcctgaagtcctgaacaaacaagggcatggctgtgaa
tcagacatttgggccctgggctgtgtaatgtatacaatgttactagggaggcccccattt
gaaactacaaatctcaaagaaacttacaggtgcataagggaagcaaggtatacaatgccg
tcctcattgctggctcctgcgaagcacttaattgctagtatgttgtccaaaaacccagag
gatcgtcccagtttggatgacatcattcgacatgacttttttttgcagggcttcactcca
gacagactgtcttccagctgttgtcacacagttccagatttccacttatcaagcccagct
aagaatttctttaagaaagcagctgctgctctttttggtggcaaaaaagacaaagcaaga
tatattgacacacataatagagtgtctaaagaagatgaagacatctacaagcttaggcat
gatttgaaaaagacttcaataactcagcaacccagcaaacacaggacagatgaggagctc
caaccacctaccaccacagttgccaggtctggaacacccgcagtagaaaacaagcagcag
attggggatgctattcggatgatagtcagagggactcttggcagctgcagcagcagcagt
gaatgccttgaagacagtacaatgggaagtgttgcagacacagtggcaagagttcttcgg
ggatgtctggaaaacatgccagaagccgattgcattcccaaagagcagctgagcacatca
tttcagtgggtcaccaaatgggttgattactctaacaaatacggcttcgggtaccagctc
tcagaccacaccgtcggtgtccttttcaacaatggtgctcacatgagcctccttccagac
aaaaaaacagttcactattacgcagagcttggccaatgctcagttttcccagcaacagat
gctcctgagcaatttattagtcaagtgacggtgctgaaatacttttctcattacatggag
gagaacctcatggatggtggagatctgcctagtgttactgatattcgaagacctcggctc
tacctccttcagtggctaaaatctgataaggccctaatgatgctctttaatgatggcacc
tttcaggtgaatttctaccatgatcacacaaaaataatcatctgtagccaaaatgaagaa
taccttctcacttacatcaatgaggacaggatatccacaactttcagactgacaactctg
ctgatgtctggctgttcattagaattaaaaaatcgaatggaatatgccctgaacatgctc
ttacagagatgtaactga

DBGET integrated database retrieval system