KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665951Help
Entry
104665951         CDS       T03989                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00020  Citrate cycle (TCA cycle)
rro00640  Propanoate metabolism
rro01100  Metabolic pathways
rro01200  Carbon metabolism
Module
rro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104665951 (SUCLG1)
   00640 Propanoate metabolism
    104665951 (SUCLG1)
Enzymes [BR:rro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104665951 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104665951 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 104665951
NCBI-ProteinID: XP_030776494
Position
17
AA seq 348 aa AA seqDB search
MTATLAAAADIATMVFGSSGLAATRLLSRNFLRELAQNGIRHCSYTASRKHLYVDKNTKI
ICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVI
YVPPPFAAAAINEAVEAEIPLVVCITEGIPQQDMVRVKHKLLRQGKTRLIGPNCPGVINP
GECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTEVGLGQSLCVGIGGDPFNGTDFID
CLEIFLNDSATEGIILIGEIGGNAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMG
HAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacccttgcggctgcggctgacatcgctaccatggtcttcggcagcagcggt
ctcgcagccacccgtctgctgtcgcgcaacttcctccgtgagttggcacagaatggaatt
cggcattgttcctatacagcttctcggaaacatctgtatgttgataaaaatacaaagatt
atttgccagggtttcactggcaaacagggcacctttcacagccagcaggcattggaatat
ggcaccaaactcgttggaggaaccactccggggaaaggaggccagacgcatctgggctta
cctgtctttaatactgtgaaggaggccaaagaacagacaggagcaacggcttctgtcatt
tatgttcctccgccctttgctgccgctgccattaatgaagctgttgaggcggaaattccc
ttggttgtgtgtatcactgaaggaattccccagcaggacatggtacgagtcaagcacaaa
ctgctgcgccagggaaagacaaggctaattgggcccaactgccctggagtcatcaatcct
ggagaatgtaaaattggcatcatgcctggccatattcacaaaaaaggaaggattggcatt
gtgtccagatccggcaccctgacttatgaagcagttcaccagacaacggaagttggattg
gggcagtctttgtgtgttggcattggaggcgatccttttaatggaacagattttattgac
tgcctcgaaatctttttgaatgattctgccacagaaggcatcatattgattggtgaaatt
ggtggtaatgcagaagagaatgctgcagaatttttgaagcaacataattcaggtccaaat
tccaagcctgtagtgtccttcattgctgggttaactgctcctcctgggaggagaatgggt
catgccggggcaattattgccggaggaaaaggtggagctaaagagaagatctccgctctt
cagagtgcaggagttgtggtcagtatgtctcctgcacagctgggaaccacgatctacaag
gaatttgaaaagaggaagatgctgtga

DBGET integrated database retrieval system