KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667209Help
Entry
104667209         CDS       T03989                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00071  Fatty acid degradation
rro01212  Fatty acid metabolism
rro03320  PPAR signaling pathway
rro04152  AMPK signaling pathway
rro04714  Thermogenesis
rro04920  Adipocytokine signaling pathway
rro04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104667209 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104667209 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104667209 (CPT1C)
   04920 Adipocytokine signaling pathway
    104667209 (CPT1C)
   03320 PPAR signaling pathway
    104667209 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    104667209 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rro03029]
    104667209 (CPT1C)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     104667209 (CPT1C)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104667209 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 104667209
NCBI-ProteinID: XP_010367806
UniProt: A0A2K6P1K3
Position
Un
AA seq 803 aa AA seqDB search
MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALLLYRHRLNRQEITPTLLMGMR
PLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRVGTHSRNSLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSEN
VDCHVFPFSLFGKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTE
TVRSCTREACNFVRAMEDTEKTDPQCLTLFRVAVDKHQALLKAAMSGQGVDRHLFALYVV
SRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YIFMGDDMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKEDS
RHRCGFLSRQTGASKTSMTSTDF
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaccctcgctgacctcggacggggctgaa
gtggaactcagtgcccctgtgctgcaggagatctacctctctggcctgcgctcctggaaa
aggcatctctcacgtttctggaatgactttctcaccggtgtgtttcctgccagccccctc
agttggcttttcctcttcagtgccatccagcttgcctggttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagttgctgcccgactggggcggacagcaccacggg
ctccggggggtcctggcagctgccctgtttgcctcctgtttgtggggagccctgatcttc
acactgcacgtggccctgaggctgcttctgtcctaccacggctggcttcttgagccccac
ggagccatgtcctcccccaccaagacctggctggccctggtccgcatcttctccggccgc
cacccgatgctgttcagttaccagcgctccctgccgcgccagcccgtgccctctgtgcag
gacaccgtgcgcaagtacctggagtcggtccggcccgtcctctccgacgaggactttgac
tggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcactgctgcagtggtac
ctgaggctcaagtcctggtgggcgtccaattatgtcagtgactggtgggaggaatttgtg
tacctgcgctcccgaaatccgctgatggtgaacagcaactattacatgatggacttcctg
tatgtcacacccacgcctctgcaggcagctcgcgctgggaatgccgtccacgccctcctc
ctgtaccgccaccgcctgaaccgccaagagataaccccgactttgctaatgggaatgcgt
cccttatgctctgcccagtatgagaagatcttcaacaccacgcggattccaggggtccaa
aaagactacatccgccacctccatgacagccagcatgtggctgtcttccaccggggccga
ttcttccgcgtggggacccactcccgaaacagcctgctttccccgagggccctggagcag
cagtttcagcgaatcctggatgatccctcaccggcctgcccccacgaggaacatctggct
gctctgaccgctgctcccaggggcacatgggcccaggtgcgaacgtccctgaagacccag
gcagcagaggccctggaggcagtggaaggggccgctttctttgtgtcactggatgctgag
cctgcggggctcaccagggaggacccagcagcgtcgttggatgcctatgcccatgccctg
ctggctggtcggggccatgaccgctggtttgacaaatccttcaccctaatcgtcttctct
aacgggaagctgggcctcagcgtggagcactcctgggccgactgccccatctcaggacac
atgtgggagttcactctggctacagaatgctttcagctgggctactcaacagacggccac
tgcaaggggcacccggaccccacactaccccagccccagcggctgcaatgggaccttcca
gaccagatccactcctccatctctctagccctgaggggagccaagatcttgtctgaaaat
gtcgactgccatgtctttccattctccctatttggcaagagcttcatccgacgctgccac
ctctcttcagacagcttcatccagatcgccttgcaactggcccacttccgggacaggggt
caattctgcctgacttatgagtcggccatgactcgcttattcctggaaggccggacggag
acggtgcggtcttgcacgagggaggcctgcaactttgtgagggccatggaggacacagag
aagacggacccacagtgcctcaccctgtttcgcgtggcagtggacaagcaccaggctctg
ctgaaggcagccatgagcgggcagggagtcgaccgccacctctttgcgctttacgtcgtg
tcccgattcctccacctgcagtcgcccttcctgacccaggtccactcggagcagtggcag
ctgtccaccagccagatccctgttcagcaaatgcatctgtttgacgtccacaattacccg
gactatgtttcctcaggcggtggattcgggcctgctgatgaccatggttatggtgtctct
tatatcttcatgggggatgacatgatcaccttccacatctccagcaaaaaatcaagcaca
aaaacggattcccacaggctggggcagcacattgaggacgcactgttggatgtggcctcc
ctgttccaggcaggacagcattttaagcgccggttcagagggtcagggaaggaggactcc
aggcacaggtgtggatttctctcccgccagactggggcctccaagacatcaatgacatcc
accgacttctga

DBGET integrated database retrieval system