KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667476Help
Entry
104667476         CDS       T03989                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104667476 (OXTR)
   04024 cAMP signaling pathway
    104667476 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104667476 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104667476 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104667476 (OXTR)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Peptide
   Oxytocin
    104667476 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 104667476
NCBI-ProteinID: XP_010368206
UniProt: A0A2K6RB62
Position
1
AA seq 389 aa AA seqDB search
MEGELAANWSTEAVNSSAAPPGAEGNSTAGPPRRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAASA
AEAPEGAAAGDGGRMALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGNRLGET
STSKKSNSSSFVLSHRSSSQRSCSQPSTA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgagctcgcagccaactggagcaccgaggcagtcaactccagcgccgcgccg
ccgggggccgagggcaacagcaccgccggacccccacggcgcaacgaggccctggcgcgc
gtggaggtggcggtgctctgtctcatcctgtttctggcgctgagcgggaatgcgtgtgtg
ctgctggcgctgcgcaccacgcgccacaagcactcgcgcctcttcttcttcatgaagcac
ctgagcatcgccgacctggtggtggcagtgttccaggtgctgccgcagttgctgtgggac
atcaccttccgcttctacgggcccgacctgctgtgccgcctggtcaagtacttgcaggtg
gtgggcatgttcgcctccacctacctgctgctactcatgtccctggaccgctgcctggcc
atctgccagccgctgcgctcgctgcgccgccgcactgaccgcctggcggtgctcgccacg
tggctcggctgcctggtggccagcgcgccgcaggtgcacatcttctctctgcgcgaggtg
gctgacggcgtcttcgactgctgggccgtcttcatccagccctggggacccaaggcctac
atcacgtggatcacgctagctgtctacatcgtgccggtcatcgtgctggctgcctgctat
ggccttatcagcttcaagatctggcagaatttgcggctcaagaccgctgcagcttcggcg
gcagaggcgccagagggcgcggcggctggcgatggggggcgcatggccctggcacgtgtc
agcagcgtcaagctcatctccaaggccaagatccgcacggtcaagatgactttcatcatc
gtgctggccttcatcgtgtgctggacgcctttcttcttcgtgcagatgtggagcgtctgg
gatgccaacgcgcctaaggaagcctcggccttcatcattgtcatgctcctggccagcctc
aacagctgctgcaacccctggatctacatgctcttcacaggtcacctcttccacgaactc
gtgcagcgtttcctgtgctgctccgccagctacctaaagggcaaccgcctgggagagaca
agtaccagcaaaaagagcaactcgtcttcctttgtcctgagccatcgcagctccagccag
aggagctgctcccagccatccacggcgtga

DBGET integrated database retrieval system