KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668560Help
Entry
104668560         CDS       T03989                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00600  Sphingolipid metabolism
rro01100  Metabolic pathways
rro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104668560 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104668560 (GALC)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     104668560 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 104668560
NCBI-ProteinID: XP_010369619
UniProt: A0A2K6PKZ0
Position
Un
AA seq 685 aa AA seqDB search
MAGWLLSASRQRRVKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNSQGLQQVKIIASDNLWESISAAMLLD
AELFKVVDVIGAHYPGTHSVKDARLTGKKLWSSEDFSTLNSDTGAGCWGRILNQNYVNGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEI
PELQVWYTKLGKTSERFLFKQLDSLWLLDSNGSFTLKLQEDELFTLTTLTTGRKGSYLLP
PKSQHFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNMEDPGEHHFTLRQVLNQRPIT
WAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIF
ANGSYRVTGDLAGWIIYALGRVEVIAKKWYTLTLTIKGRFASGMLNDKSLWTDIPVNFPK
NGWAAIGTHSFEFAQFDNFHVEATR
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgggtggctactctcggcttcccggcaacgccgagtgaaagccatgacggccgcc
gcgggttcggcgggccgcgccgcggtgcccttgctgctgtgtgcgctgttggcgcccggc
ggcgcgtacgtgctcgacgactccgacgggctgggccgggagttcgacggcatcggcgcg
gtcagcggcggcggggcaacctcccgacttctagtaaattacccagagccctatcgttct
cagatattggattatctctttaagccaaattttggtgcctctttgcatattctaaaagtg
gaaataggtggtgatgggcagacaacagatggcactgagccctcccacatgcactatgca
ctagatgagaattactttcgaggatatgagtggtggttaatgaaggaagctaagaagagg
aatcccaatattacactcattgggttgccatggtcattccctggatggctgggaaaaggt
tttgactggccttatgtcaatcttcagctgactgcctattatgtcgtgacctggattgtg
ggtgccaagcgttatcatgatttggacattgattatattggaatttggaatgagaggtca
tataatgccaattatattaagatattaagaaaaatgctgaactctcaaggtctccagcaa
gtgaaaatcatagcaagtgataatctctgggagtccatctctgcagccatgctacttgat
gccgaacttttcaaggtggttgatgttataggggctcattatcctggaacccattcagta
aaagatgcaaggttgactgggaagaagctttggtcttctgaagactttagcactttaaat
agtgacacgggtgcaggctgctggggtcgcattttaaatcagaattatgtcaatggctat
atgacttccacaatcgcatggaatttagtggctagttactatgaacagttgccttatggg
agatgcgggttgatgacagcccaggagccatggagtggtcactacgtggtagaatctcct
gtctgggtgtcagctcataccactcagtttactcaacctggctggtattacctgaagaca
gttggccatttagagaaaggaggaagctatgtagctctgactgatggcttagggaacctc
accatcatcattgaaaccatgagtcataaacattctaagtgcatacggccatttcttcct
tatttcaatgtgtcacaacaatttgctacctttgttcttaagggatcttttagtgaaata
ccagagctacaggtgtggtataccaaacttggaaaaacatccgaaagatttctttttaag
cagctggattctctatggctcctcgacagcaatggcagtttcacactgaaactgcaagaa
gatgagctgttcacactcaccactctcaccactggtcgcaaaggcagctacctgcttcct
ccaaaatcccagcacttcccaagtacctataaggatgatttcaatgttgattacccattt
tttagtgaagctccaaactttgctgatcaaactggtgtatttgaatattttacaaatatg
gaagaccctggtgagcatcacttcacgctacgccaagttctcaaccagagacccattacg
tgggctgccgatgcatccaacacaatcagtattataggagactacaactggacgaatctg
actataaaatgtgatgtttacatagagacccctgacacaggaggtgtgttcattgcagga
agagtaaataaaggtggtattttgattagaagtgccagaggaattttcttctggattttt
gcaaatggatcttacagggttacaggggatttagctggatggattatatatgctttagga
cgtgttgaagttatagcaaaaaaatggtatacactcacattaactattaagggtcgtttt
gcctctggcatgctgaatgacaagtctctgtggacagacatccctgtgaattttccgaag
aatggctgggctgcaattggaactcactcctttgaatttgcacagtttgacaactttcat
gtggaagccacacgctaa

DBGET integrated database retrieval system