KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669200Help
Entry
104669200         CDS       T03989                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00480  Glutathione metabolism
rro00590  Arachidonic acid metabolism
rro01100  Metabolic pathways
rro04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104669200 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104669200 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    104669200 (GPX7)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     104669200 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 104669200
NCBI-ProteinID: XP_010370425
UniProt: A0A2K6RT75
Position
12
AA seq 193 aa AA seqDB search
MPPPREQAMVAAAAAWLLLWAAACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVA
SECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPM
FSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITA
LVRKLILRKREDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgccacctcgggaacaagccatggtggcggcggcggcggcgtggctgctcctgtgg
gctgcggcctgcgcgcagcgggagcaggacttctacgacttcaaggcggtcaacatccgg
ggcaaactggtgtcgctggagaagtaccgcggctcggtatccctggtggtgaatgtggcc
agtgagtgcggcttcacagaccagcactaccgagccctgcagcagctgcagcgggacctg
ggtccccaccacttcaacgtgctcgccttcccctgcaaccagtttggccaacaggagcct
gacagcaacaaggagattgagagctttgcccgccgcacctatagtgtctcattccccatg
tttagcaagattgcagtcaccggtactggtgcccatcctgccttcaagtacctggcccag
acttctgggaaggagcccacctggaacttctggaagtaccttgtagccccagatggaaag
gtggtaggggcttgggacccaactgtgtcagtggaggaagtcagaccccagattacagcg
ctcgtgaggaagctcatcctacggaagcgagaagacttataa

DBGET integrated database retrieval system