KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669303Help
Entry
104669303         CDS       T03989                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00071  Fatty acid degradation
rro01212  Fatty acid metabolism
rro03320  PPAR signaling pathway
rro04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104669303 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    104669303 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    104669303 (CPT2)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     104669303 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 104669303
NCBI-ProteinID: XP_010370553
UniProt: A0A2K6P282
Position
Un
AA seq 659 aa AA seqDB search
MMVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQHSIVPTMHYQDSLPRLPIPKLED
TIRRYLSAQKPLLDDGQFRKTEQFCKSFENGIGKELHEQLVAQDKQNKHTSYISGPWFDM
YLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLN
PAKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDK
ARHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAAEFPLAYLTSENRDIW
AELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLI
ITKDGSAAVNFEHSWGDGVAVLRFFNEVFKDSTQIPAITPQSQPATADSTVTVQKLNFKL
TDALKTGITAAKEKFDATMKTLTIDCLQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQY
GQTVATYESCSTAAFKHGRTETIRPASIYTKRCSEAFVREPSRHSAGELQQMMVECSKYH
GQLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNL
GGFAPVVSDGFGVGYAVHGNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgccccgtctgctgctgcgtgcctggccccggggccctgcggttggtccggga
gcccccagtcggcccctcagcgccggctccggtcccggccagtacctgcagcacagcatc
gtgcccaccatgcattaccaggacagcctgcccaggctgcctattcccaaacttgaagac
accattaggagatacctcagtgcacagaagcctctcttggatgatggccagttcaggaaa
acagaacaattttgcaagagttttgaaaatgggattggaaaagaactgcatgagcagctg
gttgctcaggacaaacagaataaacataccagctacatttcgggaccctggtttgatatg
tacctatctgctcgagactccgttgttctgaactttaatccatttatggctttcaatcct
gacccaaaatctgagtataacgaccagctcacccgggcaaccaacatgactgtttctgcc
atccggtttctgaagacactccgggctggccttctggagccagaagtgttccatttgaac
cctgcaaaaagtgacacggacaccttcaagagactcatacgctttgtgccttcctctctg
tcctggtatggggcctacctagtcaatgcatatcccctggatatgtcccagtattttcgg
cttttcaactcaactcgtttacccaaacccagtcgggatgaactcttcactgatgacaag
gccagacacctcctggtcctaaggaaaggaaatttttatatctttgatgtcctggatcaa
gatgggaacattgtgagcccctcagaaatccaggcgcatctgaagtacattctctcagac
agcagccccgccgccgagtttcctctggcatacctgaccagtgagaaccgagacatctgg
gcagagctcaggcagaagctgatgagtagtggcaatgaggagagcctgaggaaagtggac
tcggctgtgttctgcctctgcctagatgacttccccattaaggaccttgtccacttgtcc
cacaacatgctgcatggggatggcacaaaccgctggtttgataaatcctttaacctcatt
atcaccaaggatggctctgctgccgtcaactttgagcactcttggggtgatggtgtggca
gtgctcagattttttaatgaagtatttaaagacagcactcagatccctgccatcactcca
cagagccagccagccactgctgactctactgtcactgtgcagaaactcaacttcaagctg
actgatgccttaaagactggcatcacggctgctaaggaaaagtttgatgccaccatgaaa
accctcactatcgactgcctccagtttcagagaggaggcaaagaattcctaaagaagcag
aagctgagtcctgatgcagttgcccagctggccttccagatggccttcctgcggcagtac
gggcagacagtggccacctacgagtcctgtagcactgccgcattcaagcatggccgcact
gagaccatccgcccagcctccatctatacaaagaggtgctctgaggcctttgtcagggag
ccctccaggcacagtgctggcgaacttcaacagatgatggttgaatgttccaagtaccat
ggccagctgaccaaagaagcagcaatgggccagggctttgaccgacacttgtttgctctg
cggcacctggcagcagccaaagggatcatcttgcctgagctctacctggaccctgcatac
gggcagataaaccacaatgtcctgtccacgagcacactgagcagcccagcagtgaacctt
gggggctttgcccccgtggtctctgatggctttggtgttggatatgcggttcatggcaac
tggataggctgcaatgtctcttcctacccaggccgcaatgcccgggagtttctccagtgt
gtggagaaggccttagaagacatgtttgatgccttagaaggcaaatccatcaaaagttaa

DBGET integrated database retrieval system