KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669720
Entry
104669720         CDS       T03989                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104669720 (ADAMTS13)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     104669720 (ADAMTS13)
Peptidases and inhibitors [BR:rro01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   104669720 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 TSP1_CCN Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 104669720
NCBI-ProteinID: XP_030775336
Position
16
AA seq 1436 aa
MKPSQRLALLRMRQHHPRARCPSLCVAGILACGFLLGYWGPSHFQQSFLQALEPQAVSSY
LSPGAPLKGRPPSPGFQRQRQRQRQRRAAGSILHLELLVAVGPDVFQAHQEDTERYVLTN
LNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRTINPEDDT
DPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIG
HSFGLEHDGAPGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPR
PQPGSTGRPPEAQPGLYYSANEQCRVAFGPKAVACTFAREHLDICQALSCHTDPLDQSSC
SRLLVPLLDGTECGVEKWCSKGRCRSLVELTPIAAVHGHWSSWGPQSPCSRSCGGGVVTR
RRQCNNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDGQPLHSSPGGASF
YHWGAAVPHSQGDALCRHMCRAIGENFIMKRGDSFLDGTRCVPSGSREDGTLSLCVSGSC
RTFGCDGRMDSQQVRDVCQVCGGDNSTCSPRNGSFTAGRVREYVTFLTVTPNLTSVYIAN
HRPLFTHLAVRIGGRYVVAGKTSISPNTIYPSLLEDGRVEYRVALTEDRLPRLEEIHIWG
PLQEDAEIQVYRRYGEEYGNLTCPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVN
YSCLDQARKELVETARCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSVSCGGGLRERPV
RCVEAQGSLLKTLPPARCRAGAQQPAVTAEICNPQPCPARWEMSEPSPCTSASGAGPALQ
NETCVPGADGLEAPATQGPDSIDEKLPAPEPCVGMSCPPGWGHLDATSAGEEAPSPWGSI
RTGAQAAHVWTPLAGPCSVSCGRGLMELRFLCMDSALGVPVQEELCGLASKPGSRREVCQ
AVPCPARWQYKLAACSVSCGGGVMRRILYCARAHGEDDEEEILLDTQCQGLPRPEPQEAC
SLEPCPPRWKVMSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEVACAALVRPQASVPC
LIADCTYRWYVGTWTECSVSCGDGIQRRHDTCLGPQAQAPVPADFCQHLPKPVTVRGCWA
GPCVGQGTPNLVPHEEATAPGQTTATPAGASLEWSQARALLFSPAPQPQRLLPGLQESSA
QSSACGRQHLEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRILESSLNCSAGDMLLLWGR
LTWRKMCRRLLGMTFSSKTNTLVVRQRCRQPGGGVLLRYGSQLAPETFYRECDMQLFGPW
GEIVSPATSKAGGCRLFINVAPHARIAIHALATDMDNGTKGANASYISIRDIHSLRTTTF
HGQQVLYWESESSQAEMEFSEDFLKAQASLRGQYWTLQSWVTGGPGPSSWKGKEGT
NT seq 4311 nt   +upstreamnt  +downstreamnt
atgaaaccatcccagaggctggctctcctgaggatgcgccagcatcacccccgggcaaga
tgcccttccctctgtgtggccggaatccttgcctgtggctttctcctgggctactgggga
ccctcccatttccagcagagttttcttcaggctttggagccacaggctgtgtcttcttac
ttgagccctggtgctcccttaaaaggccgccctccttcccctggcttccagaggcagagg
cagaggcagaggcagaggagggctgcaggcagcatcctacacctggagctgctggtggcc
gtgggccccgatgtcttccaggctcaccaggaggacacggagcgctatgtgctcaccaac
ctcaacatcggggcagaactgcttcgggacccgtccctgggggctcagtttcgggtgcac
ctggtgaagatggtcattctgacagagccagagggtgctccaaatatcacagccaacctt
acctcatccctgctgagcgtctgtgggtggagccggaccatcaaccccgaggacgacaca
gatcctggccacgctgacctggtcctctatatcacgaggtttgacctggagttgcctgat
ggtaaccggcaggtgcggggagtcactcagctgggtggtgcctgctccccaacctggagc
tgcctcattaccgaggacactggcttcgacctgggagtcaccatcgcccatgagatcggg
cacagcttcggcctggagcacgacggcgcgcccggcagcggctgcggccccagcggacac
gtgatggcttcagacggcgctgcgccccgcgctggcctcgcctggtccccctgcagccgc
cggcagctgctgagcctgctcagcgcaggacgggcccgctgcgtgtgggaccccccgcgg
cctcagcctgggtccacggggcgcccgccggaggcgcagcctggcctctactacagcgcc
aacgagcagtgccgcgtggccttcggccctaaggctgtcgcctgcaccttcgccagggag
cacctggatatatgccaggccctctcctgccacacagacccgctggaccaaagcagctgc
agccgcctcctcgttcctctcctggacgggacagaatgtggcgtggagaagtggtgctcc
aagggtcgctgccgctccctggtggagctgacccccatagcagcggtgcatgggcactgg
tctagctggggtccccaaagtccttgctcccgctcctgtggaggaggtgtggtcaccagg
aggcggcagtgcaacaaccccagacctgcctttgggggccgtgcgtgtgttggtgctgac
ctgcaggccgagatgtgcaacactcaggcctgtgagaagacccagctggagttcatgtcg
gaacagtgcgccaggaccgacggccagccactgcactcctcccctggcggtgcctccttc
taccactggggtgctgctgtaccacacagccaaggggatgctctgtgcaggcacatgtgc
cgggcaattggcgagaacttcatcatgaagcgtggagacagcttcctggatgggacccgg
tgtgtgccaagtggctcccgggaggacgggaccctaagcctgtgcgtgtcgggcagctgc
aggacatttggctgtgatggcaggatggactcccagcaggtacgggacgtgtgccaggtg
tgtggtggggacaacagcacgtgcagcccacggaacggctctttcacagctggaagagtg
agagaatatgtcacatttctgacggttacccccaacctgaccagtgtctacattgccaac
cacaggcctctcttcacacacttggcggtgaggatcggagggcgctacgtcgtggctggg
aagacgagcatctcccctaacaccatctacccctccctcctggaggatggccgtgttgag
tatagagtggccctcaccgaggaccggctgccccgcctggaggagatccacatctgggga
cccctccaggaagatgctgagatccaggtttacaggcggtacggcgaggagtatggcaac
ctcacctgcccagacatcaccttcacctacttccagcctaagccacggcaggcctgggtg
tgggccgctgtgcgtgggccctgctcggtgagctgtggggcagggctgcgctgggtaaac
tacagctgcctggaccaggccaggaaggagttggtggagactgcccggtgccaagggagc
cagcagccaccagcgtggccagaggcctgcgtgctggaaccttgccctccgtactgggcg
gtgggagacttcggcccatgcagtgtctcctgcgggggtggcctgcgggagcggccagtg
cgctgcgtggaggcccagggcagcctcctgaagacgttgcccccagcccggtgcagagca
ggggcccagcagccagctgtgacagcggaaatctgtaacccccagccctgccccgccagg
tgggagatgtcagagcccagcccatgcacatcagccagtggagcaggcccggccttgcag
aatgagacctgtgtgccgggggcagatggcctggaggctccagcgactcaagggcctgac
tccatagatgagaagctgcctgcccctgaaccctgtgtcgggatgtcatgccctccaggc
tggggccatctggatgccacctctgcaggggaggaggctccctccccatggggcagcatc
aggacaggggctcaagctgcacacgtgtggacccctctggcagggccgtgctccgtctcc
tgcgggcgaggcctgatggagctgcgtttcctgtgcatggactctgcactcggggtgcct
gtccaggaggagctgtgtggcctggcaagcaagcctggaagccggcgggaggtctgccag
gctgtcccgtgccctgctcggtggcagtacaagctggcggcctgcagcgtgagctgtggg
ggaggggtcatgcggaggatcctgtattgtgcccgggcccatggggaggatgatgaggag
gagatcctgttggacacccaatgccaggggctgcctcgcccagaaccccaggaggcctgc
agcctggagccctgcccacctaggtggaaagtcatgtcccttggcccatgttcggccagc
tgtggccttggcactgctagacgctcggtggcctgtgtgcagctcgaccaaggccaggat
gtggaggtggacgaggtggcctgtgcagcactggtgcggccccaggccagcgtcccctgt
ctcattgctgactgcacctaccgctggtatgtcgggacctggacggagtgctctgtttcc
tgtggggatggcattcagcgccggcatgacacctgcctcggaccccaggcccaggcgcct
gtgccggctgatttctgccagcacttgcccaagccagtgactgtgcgtggctgctgggct
gggccctgtgtgggacaggggacgcccaacctggtgcctcacgaagaagccactgctcca
ggacagaccacagccacccctgctggtgcctccctggagtggtcccaggcccgggccctg
ctcttctccccggctccccagcctcagcggctcctgcccgggctccaggaaagctcggcg
cagtccagtgcctgtggcaggcagcaccttgagccaacaggaaccattgacatgcgagga
ccagggcaggcagactgtgcagtggccattgggcggccccttggggaggtggtgaccctc
cgcatccttgagagttctctcaactgcagtgcgggggacatgttgttgctttggggccgg
ctcacctggaggaagatgtgcaggaggctattgggcatgactttcagctccaagaccaac
acgctggtggtgaggcagcgttgcaggcagccgggaggtggggtgctgctgcggtatggg
agccagcttgctcctgaaaccttctacagagaatgtgacatgcagctctttgggccctgg
ggtgaaatcgtgagtccagccacgagtaaggcagggggctgccggctcttcattaatgtg
gctccgcacgcccggattgctatccatgccctggccaccgacatggacaatgggaccaag
ggagccaatgccagctacatctcgatccgggacatccacagcttgaggaccacaacgttc
catgggcagcaggtgctctattgggagtcagagagcagccaggctgagatggagttcagc
gaggacttccttaaggctcaggccagcctgcggggccagtactggaccctccaatcatgg
gtaaccggaggaccaggaccctcgtcctggaagggaaaggaagggacctga

DBGET integrated database retrieval system