KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670653Help
Entry
104670653         CDS       T03989                                 

Gene name
ACVR1B
Definition
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04350  TGF-beta signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104670653 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670653 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104670653 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104670653 (ACVR1B)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     104670653 (ACVR1B)
Protein kinases [BR:rro01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   104670653 (ACVR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 104670653
NCBI-ProteinID: XP_010372298
UniProt: A0A2K6PTW1
Position
Un
AA seq 453 aa AA seqDB search
MVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGH
LKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMC
LSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVA
VKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFD
YLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIA
DLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWE
IARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKM
MRECWYANGAARLTALRIKKTLSQLSVQEDVKI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggtttccattttcaatctggatgggatggagcaccatgtgcgcacctgcatccccaaa
gtggagctggtccctgccgggaagcccttttactgcctgagctcagaggacctgcgcaac
acccactgctgctacactgactactgcaacaggatcgacttgagggtgcccagtggtcac
ctcaaggagcctgagcacccatccatgtggggcccggtggagctggtaggcatcatcgcc
ggcccggtgttcctcctgttcctcatcatcatcattgttttccttgtcattaactatcat
cagcgtgtctaccacaaccgccagagactggacatggaagatccctcatgtgagatgtgt
ctctctaaagacaagacgctccaggatcttgtctacgatctctccacctcagggtctggc
tcagggttacctctctttgtccagcgcacagtggcccgaaccatcgttttacaagagatt
attggcaagggtcggtttggggaagtatggcgcggccgctggaggggtggtgatgtggct
gtgaaaatattctcttctcgtgaagaacggtcttggttccgggaagcagagatataccag
acggtcatgctgcgccatgaaaacatccttggatttattgccgctgacaacaaagataat
ggcacctggacacagctgtggcttgtttctgactatcatgagcacgggtccctgtttgat
tatctgaaccggtacacagtgacaattgaggggatgattaagctggccttgtctgctgct
agtgggctggcacacctgcacatggagattgtgggcacccaagggaagcctggaattgct
catcgagacttaaagtcaaagaacattctggtgaagaaaaatggcatgtgtgccatagca
gacctgggcctggctgtccgtcacgatgcagtcactgacaccatcgacattgccccaaat
cagagggtggggaccaaacgatacatggcccctgaagtacttgatgaaaccattaatatg
aaacactttgactcctttaaatgtgctgatatttatgccctcgggcttgtatattgggag
attgctcgaagatgcaattctggaggagtccatgaagaatatcagctgccatattacgac
ttagtgccctctgacccttccattgaggaaatgcgaaaggtcgtatgtgatcagaagctg
cgtcccaacatccccaactggtggcagagttatgaggcgctgcgggtgatggggaagatg
atgcgagagtgttggtatgccaacggcgccgcccgcctgacggccctgcgcatcaagaag
acactctcccagctcagcgtgcaggaagacgtgaagatctaa

DBGET integrated database retrieval system