KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673711
Entry
104673711         CDS       T03989                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    104673711 (RDH5)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     104673711 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 104673711
NCBI-ProteinID: XP_030794648
Position
10
AA seq 318 aa
MWLPLLLGAILWAVLWLLRDRQSLPASDAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVETHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRIMNLICDPDLTKVSQCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWILPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgccatactctgggcagtgctgtggttgctcagggac
cggcagagcctgcccgccagcgatgcctttgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
accccctctggggccgaggacctgcagcgggtggcctcctcccgcctccacactaccctg
ctggatatcactgatccccagagcgtccagcaggcagccaagtgggtggagacgcatgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggatgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctgcctctgctgcagcaagcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagtctgaggcgggatgtggctcattttgggatacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtctggagaaa
accctgcaggcctgctgggcacggctacctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctgaaaatgcaacagcgcatcatgaacctgatctgtgacccggac
ctaaccaaggtgagccaatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccgggctgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctggatccttcccaagcctgcccaagcggtctactga

DBGET integrated database retrieval system