KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674106Help
Entry
104674106         CDS       T03989                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro05014  Amyotrophic lateral sclerosis (ALS)
rro05031  Amphetamine addiction
rro05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104674106 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104674106 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    104674106 (GRIA1)
   04728 Dopaminergic synapse
    104674106 (GRIA1)
   04720 Long-term potentiation
    104674106 (GRIA1)
   04730 Long-term depression
    104674106 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    104674106 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104674106 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    104674106 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    104674106 (GRIA1)
   05033 Nicotine addiction
    104674106 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104674106 (GRIA1)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   104674106 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 104674106
NCBI-ProteinID: XP_030783752
Position
3
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgtaggactgtcaacatgctgacctccttc
tgtggggccctccacgtctgcttcattactccgagctttcccgttgatacatccaatcag
tttgtccttcagctgcgccctgaactgcaggatgccctcatcagcatcatcgaccattac
aagtggcagaaatttgtctacatttatgatgctgaccggggcttatccgtcctgcagaaa
gtcctggacacagctgccgagaagaattggcaggtgacagcagtcaacattttgacaacc
acagaggagggataccggatgttgtttcaggacctggagaagaaaaaggagcgactggtg
gtggtggactgtgaatcagaacgcctcaatgctatcttgggccagattataaagctggag
aagaatggcataggctaccactacatccttgcgaatctgggcttcatggacattgactta
aacaaattcaaggagagtggcgccaatgtgacaggtttccagctggtgaactacacagac
accatcccagccaagatcatgcagcagtggaagaatagtgatgctcgagaccacactcgg
gtggactggaagagacccaaatacacctctgcgcttacctacgatggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaattgatatatctcgccgggggaatgcc
ggggattgtctggctaacccagctgttccctggggccagggcatcgacatccagagagct
ctgcagcaggtgcgatttgaaggtttgacaggaaatgtgcagtttaatgagaaaggacgc
cggaccaactacacgctccacgtgattgaaatgaaacatgatggcatccgaaagatcggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgcccaagctgggggcgat
aattcaagtgttcagaacagaacatatatcgtcacaacaatcctagaagatccttatgtg
atgctcaagaagaacgccaatcagtttgagggcaatgaccgttacgagggctactgtgta
gagctggcggcagagattgccaagcacgtgggctactcctaccgtctggagatcgtcagt
gatggaaaatacggagcccgagaccctgacacgaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtggctcccttaactatcactttggtccgggaa
gaagttatagatttctccaaaccatttatgagtttggggatctccatcatgattaaaaaa
ccacagaaatccaagccgggcgtcttctccttccttgatcctttggcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagtgtcgtcctcttcctggtcagccgcttc
agtccctatgaatggcacagtgaagagtttgaggaaggacgggaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagtttgtggttctctctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtctggtcgcatcgttggcggagtctggtgg
ttcttcaccttgatcatcatctcctcatacacagccaacctggctgccttcctgaccgtg
gagaggatggtgtctcccattgagagtgcagaggacctagcaaagcagacagaaattgcc
tacgggacgctggaagcaggatctactaaggagttcttcaggaggtctaaaattgccgtg
tttgagaagatgtggacatacatgaagtcagcagagccatcagtttttgtgcggaccaca
gaggaagggatgattcgagtgaggaaatccaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcagcggaaaccctgtgacactatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtctgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagcgct
ctgagtctcagcaatgtggcgggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttttgtttgatcccacagcaatccatcaatgaagccatacggacatcgaccctcccc
cgcaacagtggggcaggagccagcagcggcggcagtggagagaatggtcgggtggtcagc
catgacttccccaagtccatgcaatcgattccttgcatgagccacagttcagggatgccc
ttgggagccacaggattgtaa

DBGET integrated database retrieval system