KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674627Help
Entry
104674627         CDS       T03989                                 

Gene name
IDH3B
Definition
(RefSeq) isocitrate dehydrogenase [NAD] subunit beta, mitochondrial isoform X1
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00020  Citrate cycle (TCA cycle)
rro01100  Metabolic pathways
rro01200  Carbon metabolism
rro01210  2-Oxocarboxylic acid metabolism
rro01230  Biosynthesis of amino acids
Module
rro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rro_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104674627 (IDH3B)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     104674627 (IDH3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh AAA_3
Motif
Other DBs
NCBI-GeneID: 104674627
NCBI-ProteinID: XP_010377306
Position
13
AA seq 385 aa AA seqDB search
MAALSGVRWLTRALVSTGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVG
PELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
YKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESAR
GVIECLKIVTRAKSQRIAKFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELY
PKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSNMIADAVKKVIKVGKVRT
RDMGGYSTTTDFIKSVIGHLHPHGS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcactgagcggtgtccgctggctgacccgagcgttggtctccaccgggaaccct
ggggcatggagaggtctgagtacctcggccgcggcgcacgctgcatcgcggagccaggcc
gaggacgtgagggtggagggctcctttcccgtgactatgcttccgggagacggtgtggga
cctgagctgatgcacgccgtcaaggaggtgttcaaggctgccgctgtcccagtggagttc
caggagcaccacctgagtgaggtgcagaatatggcatctgaggagaagctggagcaggtg
ctgagttccatgaaggagaacaaagtggccatcattggaaagattcataccccgatggag
tataagggggagctagcctcctatgatatgcggctgaggcgtaagttggacttatttgcc
aacgtagtccatgtgaagtcacttcctgggtatatgactcggcacaacaatctagacctg
gtgatcattcgagagcagacggaaggggagtacagctctctggaacatgagagtgcaagg
ggtgtgattgagtgtttgaagattgtcacacgagccaagtctcagcggattgcaaagttc
gcctttgactatgccaccaagaaggggcggagcaaggtcactgctgtccacaaggccaac
atcatgaaacttggggatggattgttcctgcagtgctgcgaggaagttgctgaactgtac
cccaaaatcaaatttgagacaatgatcatagacaactgctgcatgcagttggtgcagaat
ccttaccagtttgatgtgctcgtgatgcccaatctctatgggaacattattgacaatctg
gctgctggcctggttgggggagctggtgtggtccctggtgagagctatagtgcagaatat
gcagtctttgagacgggtgcccggcacccatttgcccaggcagtgggcaggaatatagcc
aatcccacagccatgctgctgtcggcttccaacatgttgcggcatctcaatctcgagtat
cactccaacatgattgcagatgcagtgaagaaggtgatcaaagttggcaaggtgcggact
cgagacatgggcggctacagcaccacaaccgacttcatcaagtctgtcatcggtcacctg
cacccccatgggagctag

DBGET integrated database retrieval system