KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674668Help
Entry
104674668         CDS       T03989                                 

Gene name
MMP3
Definition
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro05202  Transcriptional misregulation in cancer
rro05215  Prostate cancer
rro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104674668 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    104674668 (MMP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104674668 (MMP3)
  09162 Cancer: specific types
   05215 Prostate cancer
    104674668 (MMP3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104674668 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rro01002]
    104674668 (MMP3)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     104674668 (MMP3)
Peptidases [BR:rro01002]
 Metallo Peptidases
  Family M10
   104674668 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Reprolysin_4 DUF4953 Reprolysin_5 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 104674668
NCBI-ProteinID: XP_010377365
UniProt: A0A2K6RH15
Position
Un
AA seq 477 aa AA seqDB search
MKSLPILLLLCVAVCSSYPLNGATRDEDTSMNFVQQYLENYYDLEKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFTTFPGIPKWRKTHLTYRIVN
YTPDLPKDAIDSAIEKAVKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTRDTTGTNLFLVAAHELGHSLGLFHSANTEALMYPLY
HSFTDLTRFRLSQDDINGIQSLYGPPPGSPETPLVPTEPVPPAPGMPATCDPALSFDAIS
TLRGEILFFKDRHFWRKSLRKLEPELYLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVQAGYPKGIHTLGFPPTVRKIDAALSVKEKKKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFAGSSQLEFDPNAKKVTHTFKSNSWLNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcttccaatcctactgttgctgtgtgtggcagtttgctcatcctatccgttg
aatggagctacaagggatgaggacaccagcatgaactttgttcagcaatatctagaaaac
tactacgaccttgaaaaagatgtgaaacagtttgttagaagaaaggacagtggtcctgtt
gttaaaaaaatccgagaaatgcagaagttccttgggttggaggtgacagggaagctggac
tctgacactctggaggtgatgcgcaagcccaggtgtggagttcctgacgttggtcacttc
acaacgtttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat
tatacaccagatctgccaaaagatgctattgattctgccattgagaaagctgtgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctctttcgcagtcagagaacacggagacttttacccttttgatggacctggaaatgtt
ttggctcatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat
gaacaatggacaagagatacaacagggaccaatttattccttgttgctgctcatgaactt
ggccattccctgggtctctttcactcagccaacactgaagctttgatgtacccactctac
cactcattcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag
tccctctatggacctccccctggatcccctgagacccccctggtacccacggaacctgtc
cctccagcacctgggatgccagccacgtgcgaccctgccttgtcctttgatgccatcagc
actctgaggggagaaatcctgttctttaaagacaggcacttttggcgcaaatccctcagg
aagcttgagcctgaattgtatttgatctcttcattttggccgtctcttccttcaggcgtg
gatgccgcatatgaagttactagcaaagatcttgttttcatttttaaaggaaatcagttc
tgggccatcagaggaaatgaggtacaagctggatacccaaaaggcatccacaccctaggt
ttccctccaaccgtaaggaaaatcgatgcagccctttctgttaaggaaaagaagaaaaca
tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca
ggctttcccaagcaaatagctgaagactttccaggaattgactcaaagattgatgctgtt
tttgaagaatttggatttttttatttcttcgctggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacacttttaagagtaacagctggcttaattgttga

DBGET integrated database retrieval system