KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675164Help
Entry
104675164         CDS       T03989                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00010  Glycolysis / Gluconeogenesis
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104675164 (MINPP1)
   00562 Inositol phosphate metabolism
    104675164 (MINPP1)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104675164 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104675164 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 104675164
NCBI-ProteinID: XP_010377933
UniProt: A0A2K6P4G9
Position
Un
AA seq 487 aa AA seqDB search
MLRAPCCPLRTSVAPAAALAAALLSSLARCSFLEPRDPVDSSLSPYFGTKTRYEDVNPGL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGSRDGGAG
NTRSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPNVADMECGPPRVNDKLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELAKA
NSTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcgccctgctgccccctgaggacctccgtagcgcctgccgcggccctggct
gcggcgctgctctcgtcgcttgcgcgctgctcttttctagagccgagggacccggtggac
tcgtcgctcagtccctatttcggcaccaagactcgctacgaggatgtcaaccccgggctg
ctatcgggccccgaagctccgtggcgggaccctgagctgctggagggaacttgcaccccg
gtacagctggtcgccctcattcgccacggcacccgctatcccacggccaaacagatccgc
aagctgaggcagctgcacgggctgctgcaggcccgcgggtccagggatggcggggccggt
aatacccgcagccgcgacctgggtgcagcgctggccgactggcctttgtggtacgcggac
tggatggacgggcagctagtagagaagggacggcaggatatgcgacagctggcgttgcgt
ctggcgtcgctcttcccggcccttttcagccgtgagaactacggccgcctgcggctcatc
accagttccaagcaccgctgcgtggatagcggcgccgccttcctgcaggggctgtggcaa
cattaccaccctggcttgccgccgcccaacgtcgcagatatggagtgtggacctccaagg
gttaatgataaactaatgagattttttgatcattgtgagaagtttttaactgaagtggaa
aaaaatgctacagctctttatcacgtggaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagctactttgcaagtgccagtaaatgatttaaatgcagattta
attcaagtagcctttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagagtatttaaatgatctgaaa
caatattggaaaagaggatatgggtatactattaacagtcgatccagctgcaccttgttt
caggatatctttcagcatttggacaaagcagttgaacagaaacaaaggtctcagccaatt
tcttctccagtcatcctccagtttggtcatgccgagacccttcttccactgctttctctc
atgggctacttcaaagacaaggaaccccttacagcttacaattacaaggaacaaatgcat
cggaagttccgaagtggtcacattgtaccttatgcctcgaacctgatatttgtgctttac
cactgtgaaaatgcaaagactcctaaagaacaattccgagtgcagatgttattaaatgaa
aaggtgttacccttggcttactcacaagaaactgtttcattttatgaagatctgaagaac
cactacaaggacatccttcagagttgtcaaaccagtgaagaatgtgaattagcaaaggcc
aacagtacatctgatgaactatga

DBGET integrated database retrieval system