KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676026Help
Entry
104676026         CDS       T03989                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit isoform X1
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04921  Oxytocin signaling pathway
rro05410  Hypertrophic cardiomyopathy (HCM)
rro05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rro05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676026 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104676026 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104676026 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    104676026 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    104676026 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    104676026 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    104676026 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104676026 (CACNG7)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104676026 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Amastin Claudin_3 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 104676026
NCBI-ProteinID: XP_010379007
UniProt: A0A2K6PEA9
Position
12
AA seq 275 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgttgagcagcgtgtttggtgcgtgtggc
ctgctcctggtgggcatcgcggtcagcactgactactggctgtacatggaagagggcaca
gttctaccgcagaaccagaccaccgaggtcaagatggccctgcacgccggcctctggaga
gtctgcttctttgcaggtcgggagaaaggtcgctgtgtggcctcagaatattttcttgaa
ccagagatcaacttggtgacggaaaacacggagaatattttgaagacagtgcgcacggct
acccccttccccatggtcagcctctttctcgtgttcacggccttcgtcatcagcaacatc
ggccacatccgcccgcagaggaccattctggctttcgtctctggcatcttcttcatacta
tcgggcctctccttggtggtgggcttggttctttacatctccagcatcaacgacgaggtc
atgaacaggcccagcagctctgagcagtattttcattatcgctacgggtggtcttttgcc
ttcgccgcttcctccttcctactcaaagagggggccggcgtgatgtccgtgtacctgttc
accaagcgctacgcggaggaggagatgtaccgtccacacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagttcctgcagcccgaggcgtggcgccgcggt
cggagcccctccgacatctccagcgacgtgtccatccaaatgacgcagaactaccctccc
gccatcaagtacccggaccacctgcacatctccacctcgccctgctga

DBGET integrated database retrieval system