KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677041Help
Entry
104677041         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00260  Glycine, serine and threonine metabolism
rro01100  Metabolic pathways
rro01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104677041
Enzymes [BR:rro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     104677041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104677041
NCBI-ProteinID: XP_030779948
Position
19
AA seq 452 aa AA seqDB search
MTNYMSLQDARAGTPRGSANYNSQRATGPAPWIPGPGRLLPSSRNSGRTDPAAPAALAGE
YKSQQLPPGWGSGRCPRHAPQTGPSDGPGTWGSPGAGVWEPRGGRTPVVGLRSDTVTTPR
PAMRHAMSEAVVGDDYGEDRQLQEMPVELLGLERTLFVPSNTMANLISVMCHCQCQGSQL
LLGQECHLHIYEQGGVAQIARVYSHSLPDLPHGTLDLAELERMITRGVRSPYHQVCELIC
LENSHSTLGGRVLSIDYLRQVHLLAQTYKARVHLDGAQLMNMALALHVPPPTLWSTVTLS
FCLSKGLGAPVGSLAGRPKDFIEEAWCLQKALGGGVHQVGVLAAAALVGLADTEQALQRD
HGNAQRFTRGLQELVLSVCPLDPTFMETDMAMVSVAGLRAGSADEMAHTGHVVCMPLFLW
TEQXAVWHRDIWAQDTELVLRKWEFVLRPLES
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacgaactacatgtccctccaggacgctcgcgcaggcacgccgcgagggagcgcgaac
tacaactcccagcgtgccacgggtcccgctccctggatccccggcccagggcgtctgctt
cccagctctaggaattctggccgcaccgaccccgccgctcccgccgccctcgctggggag
tacaaaagtcagcagctcccgccgggatggggatccgggcgctgcccgcgccatgctccg
cagactggcccgagcgacggccccggtacatggggctctccgggcgcgggcgtctgggag
cctcgcgggggtcgcacccccgtggtgggcctgcgcagcgacacggtgaccacgcccagg
ccggccatgaggcacgccatgtcagaggcagtcgtgggggacgactacggcgaagaccgg
cagctgcaagaaatgcctgtggagctgctagggctggagcgcaccctctttgtgccctcc
aacactatggccaacctcatctctgtgatgtgtcactgccagtgccagggctcccagctc
ctccttgggcaggagtgccacctccacatctatgagcagggtggggtggctcagattgct
agagtgtactcccactcccttccagacctgccccatggcaccctggacctggctgagctg
gagaggatgatcacacggggcgtccggagcccctaccaccaggtctgcgagctcatttgc
ctggagaactcacacagcaccttggggggccgggtcctctcaatcgactacctacgccag
gtgcacctcctggcccagacctacaaggcccgggtccacctggatggggcccagctgatg
aacatggcactggccctgcatgtcccaccacccacattgtggagcactgtgactctgtct
ttctgcctctccaagggcctgggtgccccagtagggtccctggctgggaggcccaaagac
ttcattgaagaagcctggtgcctccaaaaagccctgggtggaggcgtgcaccaggtgggg
gtgctggccgcggcggccctggtgggactggctgacacagagcaggcactgcagcgggac
catgggaacgcccagagattcaccagaggactccaggagctggtgttgtccgtctgcccc
cttgatcccaccttcatggagacagacatggcgatggtgagcgtggctgggttgcgggct
gggagcgctgatgagatggcccacactggccacgtggtgtgcatgccgctgttcctatgg
acagagcagntcgccgtgtggcaccgcgacatctgggcacaggacactgaactggtgctg
aggaagtgggagtttgtgctgaggccattggagtcctga

DBGET integrated database retrieval system