KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678011Help
Entry
104678011         CDS       T03989                                 

Gene name
ETFDH
Definition
(RefSeq) electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
  KO
K00311  electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104678011 (ETFDH)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.1  electron-transferring-flavoprotein dehydrogenase
     104678011 (ETFDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETF_QO DAO Thi4 FAD_binding_2 NAD_binding_8 Pyr_redox_2 Lycopene_cycl NAD_binding_9 FAD_binding_3 HI0933_like FAD_oxidored Trp_halogenase Pyr_redox_3 Fer4_7 AlaDh_PNT_C K_oxygenase GIDA
Motif
Other DBs
NCBI-GeneID: 104678011
NCBI-ProteinID: XP_010381495
UniProt: A0A2K6PUT4
Position
2
AA seq 619 aa AA seqDB search
MNMLVPLAKLSCPAYHCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWE
GVNMERFAEEADVVIVGAGPAGLSAAVRLKQLAAAHEKDIRVCLVEKAAQIGAHTLSGAC
LDPAAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGH
LVSWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELH
AKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWP
LDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSVRPTLEGGKR
IAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQL
TSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWIL
RGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLT
LRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPS
QNINWVVPEGGGGPAYNGM
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctggtgccgctagccaagctgtcctgcccggcatatcactgctttcatgcc
ttaaaaattaagaaaaattatctacctctgtgtgctacaagatggtcttcaacttctact
gtgcctcgaattactacccattatactatttatccccgggataaggacaagagatgggaa
ggagtgaacatggaaaggtttgcagaagaagcagatgttgtaatagttggtgcaggccct
gcagggctctctgcagctgttcgtctaaaacagctggctgcggcacacgaaaaggacatc
cgtgtgtgtctagtggagaaagctgcccagataggagctcatactctctcaggggcttgc
cttgatccagctgcttttaaagaactcttcccagactggaaagagaagggagctccactt
aacactcctgtaacagaagatagatttggaattttaacagagaaatacagaattcctgtg
ccaattcttccagggcttccaatgaataatcatggcaattacattgtacgcttgggacat
ttagtgagctggatgggcgaacaagcagaagcccttggtgttgaagtttaccctggttat
gcagctgctgaggtcctttttcatgacgatggtagtgtaaaaggaattgccactaacgat
gtagggatacaaaaggatggtgcaccaaaggcaacatttgagagagggctagaactacat
gctaaagtcacaatttttgcagaaggttgccatggacatctagccaagcaactatataag
aagtttgatttgagagccaattgtgaacctcagacctatgggattggactgaaggagtta
tgggttattgatgaaaagaactggaaacctgggagagtagatcacacagttggttggccc
ttggacagacatacctatggaggatctttcctctatcatttgaatgaaggtgaaccccta
gtagctcttggtcttgtggttggtctagactatcagaatccatacctgagtccatttaga
gaattccagaggtggaaacaccatcctagcgttcggccaaccttggaaggtggaaagagg
attgcatacggagccagagctctcaatgaaggtggctttcagtctataccaaaactcacc
tttcctggtggtttactaattggttgtagtcctggttttatgaatgttcccaagatcaaa
ggtactcacacagcaatgaaaagtggaattttagcagcagaatctatttttaatcaacta
actagtgaaaatctccaatcaaagacaataggactccatgtaactgaatatgaagacaat
ttgaagaactcctgggtatggaaagagctctattctgttagaaatataagaccgtcttgc
cacggagtactgggtgtatatggagggatgatttacactggaatcttttactggatattg
agaggaatggagccatggactctgaaacataaaggttctgactttgaacggcttaagcca
gccaaggattgtacacctattgagtatccaaaacccgacggacagatcagttttgacctc
ttgtcatctgtggctctgagtggtactaatcatgaacatgaccagccggcacatttaacc
ttaagggatgacagtatacctgtaaatagaaatctgtcgatatacgatgggcccgagcag
cgattctgtcctgcaggagtttatgaatttgtacctgtggaacaaggtgatggatttcgg
ttacagataaatgctcagaactgtgtgcattgtaaaacatgtgatattaaagatccaagt
cagaatattaactgggtggtacctgaaggtggaggaggacctgcttacaatggaatgtaa

DBGET integrated database retrieval system