KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678421
Entry
104678421         CDS       T03989                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104678421 (AKAP5)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     104678421 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 104678421
NCBI-ProteinID: XP_010381997
UniProt: A0A2K6NKS3
Position
5
AA seq 427 aa
METTVSEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKAWKPKVGSEAADVAR
KCPQEAGASDQPEPPRGAWASLKRLVTRRKRSESSKQQKPLEAEVQPAINAEDVDLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPSNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDDGHSAIQTGTLILEEIETVKEKQ
DVQPQQAGPLETSETDHQQTVLSDVPPLPAIPAQQIVEEASNNILKSAPNGKDYESREIV
AEETKPKDTELSQESDFKENGITEEKSKLEESKRIEPIAIIITDTEISEFDVKKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacagtttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaagacagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagccaaagcatggaagcccaaagttggctctgaagctgctgatgtggcaagg
aagtgtccccaagaagcaggagcttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagcca
ttggaggctgaagtgcaacctgcaataaacgctgaggatgttgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaactcagaccccatcaaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaagtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagatgacgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacggtcaaggaaaaacaa
gatgttcaaccccagcaagcaggcccacttgaaacttcagaaacagaccatcagcaaaca
gtactttctgatgttccacctttacctgcaatcccagctcaacaaattgtggaagaagcc
agtaacaatatcctaaaaagtgcaccaaatgggaaagactatgaaagtagagagattgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaaatccaaattagaagaaagcaaacgaatagagccaattgctatt
attattacagacactgaaatcagtgaatttgacgttaagaaatcaaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctctcgtc
aagaatgctattcagttgtcaatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system