KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678425Help
Entry
104678425         CDS       T03989                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03040  Spliceosome
rro04010  MAPK signaling pathway
rro04141  Protein processing in endoplasmic reticulum
rro04144  Endocytosis
rro04213  Longevity regulating pathway - multiple species
rro04612  Antigen processing and presentation
rro04915  Estrogen signaling pathway
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05162  Measles
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104678425 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104678425 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104678425 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104678425 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    104678425 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104678425 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    104678425 (HSPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    104678425 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    104678425 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104678425 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104678425 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rro03041]
    104678425 (HSPA2)
   03009 Ribosome biogenesis [BR:rro03009]
    104678425 (HSPA2)
   03110 Chaperones and folding catalysts [BR:rro03110]
    104678425 (HSPA2)
   04131 Membrane trafficking [BR:rro04131]
    104678425 (HSPA2)
   03051 Proteasome [BR:rro03051]
    104678425 (HSPA2)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104678425 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104678425 (HSPA2)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104678425 (HSPA2)
Spliceosome [BR:rro03041]
 Complex B
  Other components
   Prp19 complex
    104678425 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    104678425 (HSPA2)
Ribosome biogenesis [BR:rro03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104678425 (HSPA2)
Chaperones and folding catalysts [BR:rro03110]
 Heat shock proteins
  HSP70 / DNAK
   104678425 (HSPA2)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104678425 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104678425 (HSPA2)
Proteasome [BR:rro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104678425 (HSPA2)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104678425 (HSPA2)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104678425 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG DUF1464 DDR CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 104678425
NCBI-ProteinID: XP_010382001
Position
5
AA seq 639 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgtggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccct
agctacgtggccttcacggacaccgaacgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggcttattggacggaagttcgag
gatgccacagtgcagtcggacatgaaacactggccattccgggtggtgagcgagggaggc
aagcccaaagtgcaagtggagtacaagggggagaccaagaccttcttcccagaggagata
tcctccatggtcctcacgaagatgaaggagatcgcagaagcctacctggggggcaaggtg
cacagcgcggtcataacggtccccgcctatttcaacgactcgcagcgccaggccaccaag
gacgctggcaccatcacggggctcaatgtgctgcgcatcatcaacgagcccacggcggcg
gccatcgcctacggcctggacaagaagggctgtgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggtggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacggccggcgacactcacctgggcggtgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcctaacaag
cgcgccgtgaggcggctgcgcaccgcctgtgagcgcgccaagcgcaccctgagctcgtcc
acgcaggcgagcatcgagatcgactcgctctacgagggcgtggacttctatacgtccatc
acccgcgcccgcttcgaggagctcaatgccgacctctttcgcgggaccctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccactcgtatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcagtggcctatggcgccgcggtgcaggcg
gccatcctcatcggcgacaaatcggagaatgtgcaggacctgctgctacttgacgtgacc
ccgttgtcgctgggcatcgagacagctggcggtgtcatgaccccactcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtgctggtgcaggtatacgagggcgaacgggccatgaccaaggacaataacctgttgggc
aagttcgacctgaccgggattccccctgcacctcgcggggtcccccagatcgaggtcacc
ttcgacattgacgccaatggcatccttaacgttaccgccgccgacaagagcaccggtaag
gaaaacaaaatcaccatcaccaacgacaaaggtcgtctgagcaaggacgacattgaccga
atggtgcaggaggcggagcggtacaaatcggaagatgaggcgaatcgcgaccgagttgcg
gccaaaaacgccctggagtcctatacctacaacatcaagcagacagtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagatgagtatgaacacaagcagaaa
gagctcgaaagagtttgcaaccccatcatcagcaaactttaccaaggtggtcctggcggc
ggcagcggcggcggcggttcaggagcctccgggggaccgaccatcgaagaagtggactaa

DBGET integrated database retrieval system