KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679498Help
Entry
104679498         CDS       T03989                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04072  Phospholipase D signaling pathway
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04520  Adherens junction
rro04910  Insulin signaling pathway
rro04913  Ovarian steroidogenesis
rro04923  Regulation of lipolysis in adipocytes
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease (NAFLD)
rro04960  Aldosterone-regulated sodium reabsorption
Module
rro_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104679498 (INSR)
   04015 Rap1 signaling pathway
    104679498 (INSR)
   04010 MAPK signaling pathway
    104679498 (INSR)
   04066 HIF-1 signaling pathway
    104679498 (INSR)
   04068 FoxO signaling pathway
    104679498 (INSR)
   04072 Phospholipase D signaling pathway
    104679498 (INSR)
   04022 cGMP - PKG signaling pathway
    104679498 (INSR)
   04151 PI3K-Akt signaling pathway
    104679498 (INSR)
   04152 AMPK signaling pathway
    104679498 (INSR)
   04150 mTOR signaling pathway
    104679498 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104679498 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104679498 (INSR)
   04923 Regulation of lipolysis in adipocyte
    104679498 (INSR)
   04913 Ovarian Steroidogenesis
    104679498 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104679498 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    104679498 (INSR)
   04213 Longevity regulating pathway - multiple species
    104679498 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    104679498 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    104679498 (INSR)
   04931 Insulin resistance
    104679498 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104679498 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:rro04090]
    104679498 (INSR)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104679498 (INSR)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   104679498 (INSR)
CD molecules [BR:rro04090]
 Proteins
  104679498 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 104679498
NCBI-ProteinID: XP_010383405
Position
Un
AA seq 1396 aa AA seqDB search
MGTLQRKPLIPAGCRVYRARDENTGPRFHVHEASSAPILLTHPPCVCSPVFAYCSFSLLV
CPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVY
GLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCY
LATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSH
CQKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYH
FQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGP
CPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGY
LKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLF
FHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILL
RWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQN
HPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNS
SSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDS
QKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGD
IGNVTAAVPTVAAFPNTSSTSTPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACN
QDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLYEV
SYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTD
YLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVF
PCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLR
ERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNP
GRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYE
TDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVL
KFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHS
EENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNG
GKKNGRILTLPRSNPS
NT seq 4191 nt NT seq  +upstreamnt  +downstreamnt
atgggcactttacagagaaaaccactcatcccggctggctgcagggtttacagggcccgg
gatgaaaacacagggcccaggtttcacgtccatgaggccagttctgccccgatccttctg
acgcatccaccgtgcgtctgctcacctgtctttgcttactgttcattttctcttctagtg
tgtcctggcatggatatccggaacaacctcaccaggttacacgagctggagaattgctct
gtcattgaaggacacttgcagatactcttgatgttcaaaacgaggcccgaagatttccga
gacctcagtttccccaaactcataatgatcactgattacttgctgctcttccgggtctat
gggcttgagagcctgaaggacctgttccccaacctcacggtcatccggggatcacgactg
ttctttaactacgcgctggtcatcttcgagatggttcacctcaaggaactcggcctctac
aacctaatgaacatcacccggggttctgtccgcattgagaagaacaacgagctctgttac
ttggccactatcgactggtcccgcatcctggattccgtggaggataattacatcgtgttg
aacaaagatgacaacgaggagtgcggagacatctgtccgggtacagcgaagggcaagacc
aactgccccgccaccgtcatcaatgggcagtttgtcgaacggtgttggactcatagtcac
tgccagaaagtttgcccaaccatctgtaagtcacacggctgcactgccgaaggcctctgt
tgccacagcgagtgcctgggcaactgttctgagcccgacgaccccaccaagtgcgtggcc
tgccgcaacttctacctggacggcaggtgtgtggagacctgcccgcccccgtactaccac
ttccaggactggcgctgtgtgaacttcagcttctgccaggacctgcaccacaaatgcaag
aactcgcggaggcagggctgccaccagtacgtcattcataacaacaagtgcatccctgag
tgtccctccgggtacacgatgaattccagcaacttgctgtgcaccccgtgcctgggcccc
tgtcccaaggtatgccacctcctagaaggcgagaagaccatcgactcggtgacgtctgcc
caggagctccgaggatgcactgtcatcaacgggagtctgatcatcaacattcgaggaggc
aataatctggcagctgagctagaagccaacctcggcctcattgaagaaatttcagggtat
ctaaaaatccgccgatcctacgctctggtgtcactttccttcttccggaagttacgtctg
attcgaggagagaccttggaaatcgggaactactccttctatgccttggacaaccagaac
ctaaggcagctctgggattggagcaaacacaacctcaccatcactcaggggaaactcttc
ttccactataaccccaaactctgcttgtcagaaatccacaagatggaagaagtttcagga
accaaggggcgccaggagagaaatgacattgccctgaagaccaatggggaccaggcatcc
tgtgaaaatgagttacttaaattttcttacattcggacatctttcgataagatcttgctg
agatgggagccgtactggccccccgacttccgagacctcctggggttcatgctgttctac
aaagaggccccttaccagaatgtgacggagtttgacgggcaggatgcgtgtggttccaac
agttggacggtggtagacattgacccgcccctgaggtccaacgaccccaaatcacagaac
cacccaggatggctaatgcggggtctcaagccctggacccagtatgccatctttgtgaag
accctggtcaccttttcggatgaacgccggacctacggggccaagagtgacatcatttat
gtccagacagatgctaccaacccctccgtgcccctggatccaatctcagtatctaactca
tcatcccagattattttgaagtggaaacccccctctgaccccaacggcaacatcacccac
tacctggttttctgggagaggcaggcggaagacagtgagctgttcgagctggattattgc
ctcaaagggctgaagctgccctctaggacctggtctccaccattcgagtctgaagattct
cagaagcacaaccagagtgaatatgaggattcagccggtgaatgttgctcgtgtccaaag
acagactctcagatcctgaaggagctggaggagtcctcgtttcggaagacgtttgaggat
tacctgcacaacgtggttttcgtccccaggccatctcggaaacgcaggtcccttggcgat
attgggaatgtgacggcggctgtgcccacggtggcagctttccccaacacttcctcgacc
agcacgcccacgagtccggaggagcacaggccctttgagaaggtggtgaacaaggagtcg
ctggtcatctccggcttgcgacacttcacgggctatcgcatcgagctgcaggcttgcaac
caagacacccctgaggaacggtgcagtgtggcagcctacgtcagcgccaggaccatgcct
gaagccaaggctgatgacattgttggccctgtgacgcacgaaatctttgagaacaacatc
gtccacttgatgtggcaggagccgaaggagcccaatggtctgatcgtgctgtatgaagtg
agttatcggcgatatggcgatgaggagctgcatctctgtgtctcccgcaagcacttcgct
ctggaacggggctgcaggctgcgcgggctgtctccagggaactacagcgtgcgagtccgg
gccacctccctcgcgggcaacggctcctggacggaacccacctatttctacgtcacagac
tatttagatgtcccgtcaaatattgcaaaaattatcatcggccccctcatctttgtcttt
ctcttcagtgttgtgattggaagtatttatctattcctgagaaagaggcagccagatggg
ccactgggaccgctttacgcttcttcaaaccctgagtatctcagtgccagtgatgtgttt
ccatgctctgtgtacgtgccggacgagtgggaggtgcctcgagagaagatcaccctcctt
cgagagctggggcagggctcctttggtatggtgtatgagggcaacgccagggacatcatc
aagggtgaggcagagacccgcgtggcagtgaagacggtcaacgagtcagccagtctccga
gagcggattgagttcctcaatgaggcctcggtcatgaagggcttcacctgccatcatgtg
gtgcgcctcctgggagtggtgtccaagggccagcccacgctggtggtgatggagctgatg
gctcacggagacctgaagagctacctccgttctctgcggccagaggctgagaataatcct
ggccgccctccccctaccctgcaagagatgattcagatggcagcggagattgctgatggg
atggcctacctgaatgccaagaagtttgtgcatcgggacctggcagcaagaaactgcatg
gttgcccatgattttactgtcaaaattggagactttggaatgaccagagacatctatgaa
actgattactaccggaaagggggcaagggtctgctccctgtacggtggatggcgccggag
tccctgaaggatggggtctttaccacttcttctgacatgtggtcctttggcgtggtcctt
tgggaaatcaccagcttggcagaacagccttaccaaggcctgtctaatgaacaggtgttg
aaatttgtcatggacggagggtacctggatcaacctgacaactgtccagagagagtcact
gacctcatgcgcatgtgctggcaattcaaccccaagatgaggccaaccttcctggagatt
gtcaacctgctcaaagacgacctgcaccccagctttccggaggtgtccttctttcacagc
gaggagaacaaggcccccgagagtgaggagctggagatggagtttgaggacatggagaat
gtgccgctggaccgttcctcgcactgtcagagggaggaggcggggggccgggatggaggg
tcctcgctaggtttcaagcggagctacgaggaacacatcccttacactcacatgaacgga
ggcaagaaaaacgggcggatcctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system