KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679697
Entry
104679697         CDS       T03989                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104679697 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104679697 (ASIC1)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   104679697 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 104679697
NCBI-ProteinID: XP_010383663
UniProt: A0A2K6PZA8
Position
10
AA seq 574 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGELLMAPVPFPCHGHGMAPYHPKAGCSLLSHEGPPPQRPFPKPCCLGD
IGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRH
NPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtcagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcattgtgggccctgtgcttcctgggctcgctggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccatgtcaccaagctcgacgaggtg
gctgcctctcagcttactttccctgctgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgctggggagcttctggccctgctcaacaac
aggtatgagataccagacacacagatggcagacgaaaagcagctggagatattgcaggac
aaagccaacttccgcagcttcaaacccaaacccttcaacatgcgtgagttctatgaccga
gctgggcacgacattcgagacatgctgctctcctgccacttccggggagaggtctgcagt
gctgaagacttcaaggtggtcttcacacgctatggaaagtgctacacgttcaactcgggc
cgagatgggcggccacggctgaagaccatgaagggtgggacaggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
ttcgaagcaggcatcaaagtgcagatccatagtcaggatgaacctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacctttgtggcctgccaggagcagcggctc
atctacctgccgccgccctggggcacctgcaaagctgttaccatggactcggatttggat
ttcttcgactcctacagcatcaccgcctgccgcatcgactgtgagacgcgctacctggtg
gagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactccagag
cagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtac
tgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaggagctgtccatggtcaag
atccccagcaaagcctcagccaagtacctggccaagaagttcaacaaatctgagcaatac
ataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatt
gaacagaagaaggcctatgagattgcagggctcctgggtgagctgctgatggcacctgtc
cccttcccatgccatgggcatggcatggctccctatcatccaaaagcagggtgctcactt
ctgtcccatgagggtcctccaccccagaggcccttccccaaaccctgttgtcttggtgac
atcgggggccagatggggctgttcatcggcgccagcatcctcacggtgctggagctcttt
gactacgcctacgaggtcattaagcacaagctgtgccgacgaggaaagtgccagaaggag
gccaaaaggagcagtgcggacaagggcgtggccctcagcctggacgacgtcaaaagacac
aacccgtgcgagagcctccggggccaccctgccgggatgacatacgctgccaacatccta
cctcaccatccggcccgaggcacgttcgaggactttacctgctga

DBGET integrated database retrieval system