KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679775
Entry
104679775         CDS       T03989                                 

Definition
(RefSeq) cytochrome P450 11B2, mitochondrial isoform X1
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00140  Steroid hormone biosynthesis
rro01100  Metabolic pathways
rro04925  Aldosterone synthesis and secretion
Module
rro_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    104679775
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    104679775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rro00199]
    104679775
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     104679775
    1.14.15.5  corticosterone 18-monooxygenase
     104679775
Cytochrome P450 [BR:rro00199]
 Cytochrome P450, animal type
  CYP11 family
   104679775
SSDB
Motif
Pfam: p450 DUF765
Other DBs
NCBI-GeneID: 104679775
NCBI-ProteinID: XP_010383781
UniProt: A0A2K6RX51
Position
17
AA seq 503 aa
MALRAKAEVCMAAPWLSLQRAQALSTRASRAPSTVLPFEAIPQRPGNRWLRLLQIWREQG
YEHLHLELHQTFQELGPIFRYHLGGPRMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALRKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTGIVAELLLNAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNPAVFPRP
ERYNPQRWLDIRGSGKNFHNVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTFPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcatggcagcaccctggctgtccctgcaaagg
gcacaggcactaagcactagagcctctcgggcccccagtaccgtgctgccctttgaagcc
ataccccagcgtccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggagctgcaccagaccttccaggaactggggcccattttcagg
taccacttgggaggaccacgcatggtgtgtgtgatgctgccggaggacgtggagaagcta
cagcaggtggacagcctgcatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaatgggcctgaatggcgcttcaat
cgattgcggctgaacccagatgtgctgtcgcccaaggccgtgcagaggttcctcccgatg
gtggacgcggtggccagggacttctcccaggccctgaggaagaaggtgctgcaaaacgcc
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggccacagccccagctctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctatcaggaactggctttc
agccgccctcaacactacacaggcatcgtggcggaactcctgttgaatgcagaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgactgcg
tttccgttgctgatgacactctttgagctggctcggaaccccgacgtgcagcaggccctg
cgccaggagagcctggccgccgctgccagcatcagtgaacatccccagaaggcaaccact
gagctgcccttgctgcgggcggccctcaaggagaccttgaggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtgcaggttttcctctactcgctgggtcgcaaccccgccgtgttcccgaggcct
gagcgctataatccccagcgctggctagacatcaggggctctggaaagaacttccacaac
gtgccctttggctttggcatgcgccagtgcctggggcggcgcctggcagaagcggagatg
ctgctgctgctgcaccatgtgctgaaacacttcctggtggagacactaacccaagaggat
ataaagatggtctacagcttcatattgaggcccggcacgttccccctcctcactttcaga
gcgatcaactag

DBGET integrated database retrieval system