KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682360Help
Entry
104682360         CDS       T03989                                 

Gene name
MARS1
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00450  Selenocompound metabolism
rro00970  Aminoacyl-tRNA biosynthesis
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104682360 (MARS1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104682360 (MARS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rro01007]
    104682360 (MARS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rro03016]
    104682360 (MARS1)
Enzymes [BR:rro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104682360 (MARS1)
Amino acid related enzymes [BR:rro01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104682360 (MARS1)
Transfer RNA biogenesis [BR:rro03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104682360 (MARS1)
 Prokaryotic type
   Other AARSs
    104682360 (MARS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_C_3 GST_N_2 GST_N DUF16
Motif
Other DBs
NCBI-GeneID: 104682360
NCBI-ProteinID: XP_030794329
Position
10
AA seq 908 aa AA seqDB search
MRLFVSEGAPGCLPVLAAAGRARGRAELLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTYIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSSPEGRAVTNEPEEEELATLSEEEIAMAVTAW
ENGLESLPPLRPQQNPVLPVTGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHIIHADIYRWFNISFDTFGRTTTP
QQTKITQDIFQRLLTRGFVLQDTVEQLRCERCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAVELKKPQCKVCRSCPVVQSTHHLFLDLPKLEKRLEEWLGRTLPGSDWTPNARF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHGIVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTPDDQRLLAHVTLELQRYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQLEETFDLKAKTSPKPAVIE
TVTTAGPQQIQALMDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLAVAEGKPPE
APKGKKKK
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagcgagggcgccccgggttgcttgccggtgctggccgcggccggg
agagcccggggcagagcagagctgctcatcagcactgtaggccccgaagactgtgtggtc
ccgttcctgacccggcctaaggttcctgtcttgcagctggatagtggcaactacctcttc
tccactagtgcaatctgccgatatttctttttgttatctggctgggagcaagatgacctc
actaaccagtggctggaatgggaagcgacagagctgcagccagctttgtctgctgccctg
tactatttagtggtccaaggcaagaagggggaagatgttcttggttcagtgcggagagcc
ctgacttacattgaccacagcttgagtcgtcagaactgtcctttcctggctggggagaca
gaatctctagccgacattgttttgtggggagccctatacccattactgcaagatcctgcc
tacctccctgaggagctgagtgccctgcacagctggttccagacactgagtactcaggag
ccatgtcagcgagctgcagagactgtactgaaacagcaaggtgtcctggctctccggcct
tacctccaaaagcagccccagcccagctcccctgagggaagggctgtcaccaatgagcct
gaggaggaggagctggctaccctatctgaggaggagattgctatggctgttactgcctgg
gagaacggcctagaaagtttgcccccgttgcggccccagcagaatccagtgttgcctgtg
actggggaaaggaatgtgctcatcaccagtgccctcccttacgtcaacaatgtcccccac
cttgggaacatcattggttgcgtgctcagtgccgatgtctttgccaggtactctcgcctc
cgccagtggaacaccctctatctgtgtgggacagatgagtatggtacagcgacagagacc
aaagctatggaggagggactaaccccccaggagatctgtgacaagtaccacatcatccat
gctgacatctaccgctggtttaacatttcgtttgatacttttggtcgcaccaccactcca
cagcagaccaaaattacccaggacattttccagcggttgctgacacgaggttttgtgctg
caagatactgtggagcaactgcggtgtgagcgctgtgctcgcttcctggccgaccgcttc
gtggagggtgtatgtcccttctgtggctatgaggaggctcggggtgaccagtgtgacaaa
tgtggcaagctcatcaatgctgtcgagcttaagaagcctcagtgtaaagtctgccgatca
tgccctgtggtgcagtcgacccatcacctgtttctggacctgcctaagctggagaagcga
ctggaggagtggttggggaggacattgcctggcagtgactggactcccaatgcccggttt
atcacccgctcttggcttcgggatggcctcaagccacgctgcataacccgagacctcaaa
tggggaacccctgtacccttagaaggttttgaagacaaggtattctatgtctggtttgat
gccactattggctatttgtccatcacagccaactacacagaccagtgggagagatggtgg
aagaacccagagcaagtggacctatatcagttcatggccaaagacaatgtccctttccat
gggatagtctttccttgctcagccctaggagctgaggataactataccttggtcagccac
ctcattgctacagagtacctgaactatgaggatgggaaattctctaagagccggggtgtg
ggagtgtttggggacatggcccaggacacggggatccctgccgacatctggcgcttctat
ctgctgtacattcggcctgagggccaggacagtgctttctcctggacagacctgctgctg
aagaataattctgagctgcttaacaacctgggcaacttcatcaacagagctgggatgttt
gtgtctaagttctttgggggctatgtgcctgagatggtgctcacccctgatgatcagcgc
ctgctggcccatgtcaccctggagctccagcgctatcaccagctgcttgagaaggttcgg
atccgggatgccttgcgcagtatcctcaccatatctcgacatggcaaccaatacattcag
gtgaatgagccctggaagcggattaaaggcagtgaggctgacaggcaacgggcaggcaca
gtgactggcttggcagtaaatatagctgccttgctctctgtcatgcttcagccttacatg
cccacggttagtgccacaatccaggcccagctgcagctcccacctccagcctgcagtatc
ctgctgacaaacttcctgtgtaccttaccagcaggacaccagattggcacagtcagtccc
ttgttccaaaaattggaaaatgaccagattgaaagtttaaggcagcgctttggagggggc
cagctagaagagaccttcgacttaaaggcaaaaacgtccccaaagccagcagttatagag
actgttacaacagccgggccacagcagatacaagcgctgatggatgaagtgacaaaacaa
ggcaacattgtccgagaactgaaagcacaaaaggcagacaagaaccaggttgctgcggag
gtggcgaaactcttggatctaaagaaacagttggctgtagctgagggaaaaccccctgaa
gcccctaaaggcaagaagaaaaagtaa

DBGET integrated database retrieval system