KEGG   Rickettsia rickettsii Hlp#2: RPK_00875Help
Entry
RPK_00875         CDS       T01739                                 

Gene name
ruvC
Definition
(GenBank) Holliday junction resolvase
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
rrp  Rickettsia rickettsii Hlp#2
Pathway
rrp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rrp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RPK_00875 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rrp03400]
    RPK_00875 (ruvC)
Enzymes [BR:rrp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     RPK_00875 (ruvC)
DNA repair and recombination proteins [BR:rrp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RPK_00875 (ruvC)
    RecFOR pathway proteins
     RPK_00875 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: AFB28476
Position
161693..162166
Genome map
AA seq 157 aa AA seqDB search
MIILGIDPALGSLGWAVVAKETAQLKYLASGIIRTNSKDAMHHRLAFINSTLEKVILEYQ
PNMAAIEETFVNTNSVTSLKLGYARGAIMSLIGRYNLDMREFKPNTVKKTVTGYGHAEKD
QMLHMIKLLLSGTALITNSDEADAVAIAYTCLVTKNY
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgataatacttggaattgatccggcacttgggagtcttggatgggcagtagtggcaaag
gagaccgcacagttgaaatatttagctagtggtattattagaacaaatagtaaggatgca
atgcatcatagacttgcttttatcaatagtacattagaaaaagtaatattagaatatcaa
ccaaatatggcagcgattgaagaaacatttgttaatactaatagcgtgacttctttaaag
cttggatatgctagaggggcgataatgtcgctgatcggtagatataatttggacatgcgc
gagtttaagccaaatacggtaaaaaaaaccgtaacaggatatgggcatgcagagaaagac
caaatgttgcatatgataaagcttttgctgtctggcactgccttaattaccaattctgat
gaagctgacgccgtagcgattgcctatacctgcttagttacaaaaaattattaa

DBGET integrated database retrieval system