KEGG   Rickettsia rickettsii Hlp#2: RPK_05790Help
Entry
RPK_05790         CDS       T01739                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rrp  Rickettsia rickettsii Hlp#2
Pathway
rrp00450  Selenocompound metabolism
rrp00970  Aminoacyl-tRNA biosynthesis
rrp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RPK_05790
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPK_05790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rrp01007]
    RPK_05790
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rrp03016]
    RPK_05790
Enzymes [BR:rrp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RPK_05790
Amino acid related enzymes [BR:rrp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RPK_05790
Transfer RNA biogenesis [BR:rrp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RPK_05790
 Prokaryotic type
   Other AARSs
    RPK_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AFB29336
Position
complement(979514..981040)
Genome map
AA seq 508 aa AA seqDB search
MNNTYYITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAA
INKNIDPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEG
FYEGWYAVRDEAFFDESELTRDGLAPTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDF
IRPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLD
EQSNYGKFWPADLHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNDGQKISKSL
GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFVRSNLITRINSELSNKIGNLLQRTTS
FVYKNNDAKVPLLTQGVIDKIYELPILKTASKCVEQNILLMDKTEINKILENIINLAEEA
NIYIDSEAPWNLKKTDPDKTLEVLYALLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER
LFKHLIRDYTLTAGSNILEPTIIFPKFE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacttactacattactacccctatatattacgttaatgatattccccatatc
ggtcatgcttatactagcgttgcaagtgacgtaatcgctcgtttcatgcgacttcgaggt
ttcgatgtaatgtttttaacaggtactgacgaacatgggcagaaagtagaaaaagcagct
attaataaaaatattgacccacaaaaatttaccgatcaaacatccgagagttttcgtcat
ctgatgactgctatgcatatttccaatgatgattttatcagaacaacggaacacagacat
aaagaagctgtagctgttttttggcagaaattactagataacggcaccatttatgaaggt
ttttatgaagggtggtatgcagtgcgagatgaggctttttttgatgagtcggaacttacg
agggacggtttagcaccgacgggtgctccagttgaatgggttaaagagcctagctatttc
tttaatctttcaaagtggcaggataaattgcttgagttttatgaagcaaaccctgatttt
atcagacctatatcaaggcgtaacgaagtaattagctttgttaaatcgggtttaaaagat
ttatcggtatcgcgtactacttttaactggggaataaaagtgccaaataatgaaaaacat
gtaatttatgtttggcttgatgcactggctaattatatttcagcactcggttatcttgac
gaacaaagtaattacggtaagttttggccggctgatttacatgtagtcggtaaagatatc
ttgcgttttcatgccgtctattggcctgctttcttaatggctgcagaagttccgctgccg
aaaacaattatggctcatggctggtggacgaatgatgggcagaaaatctctaaatctctt
ggtaataccattgatccgattaagttaattgatgaattcggtgttgatcaagttaggtat
tttctgatgcgtgaagtaacttttggtgcggacggcaattttgttcgtagtaatttaatt
acccgtattaatagcgagttgtcaaacaaaataggtaatttattacagcgtactacatct
tttgtttataagaataatgatgccaaagtgcctttgcttacgcaaggtgttatagataaa
atatatgagctaccgattttaaaaactgcaagtaaatgtgtcgagcagaatattttattg
atggacaaaacagagattaataaaattcttgaaaatattattaatttggccgaagaggca
aatatctatattgatagcgaagcaccctggaatttgaaaaaaaccgatccagataaaacg
ttagaagtgttatatgctttactagaagttttacgctatattgcgataatgcttctgcct
tttataccgagttcagcaaataaaatgcttgatcagttaggggtaaataaagaagaacgt
ctatttaagcatttaatacgtgattatactttaacagcgggtagcaatattttagaacct
accataatttttccaaaatttgaatag

DBGET integrated database retrieval system