KEGG   Roseiflexus sp. RS-1: RoseRS_0752Help
Entry
RoseRS_0752       CDS       T00542                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00010  Glycolysis / Gluconeogenesis
rrs00071  Fatty acid degradation
rrs00350  Tyrosine metabolism
rrs00625  Chloroalkane and chloroalkene degradation
rrs00626  Naphthalene degradation
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
rrs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_0752
  Lipid metabolism
   00071 Fatty acid degradation
    RoseRS_0752
  Amino acid metabolism
   00350 Tyrosine metabolism
    RoseRS_0752
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RoseRS_0752
   00626 Naphthalene degradation
    RoseRS_0752
Enzymes [BR:rrs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RoseRS_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 Methyltransf_11 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABQ89168
UniProt: A5URB5
Position
complement(931815..932840)
Genome map
AA seq 341 aa AA seqDB search
MTTMKAAVVHDFHQPLRIEELPKPEPGFGEIVVKIEASGLCHTDIHAAHGDWPVKPKLPF
IPGHEGVGIVESVGAGVTNVKEGDRVAIPWLGYACGDCKYCASGWETLCERQLNTGYFLD
GAYAQYAKAYAKYVGIVPAGVSALDAAPLTCAGVTTYKAVKVSGARPSELVAVFGVGGLG
HLALQYAKIAGATVAAIDLLDERLQTARELGADITINASTHDPVEELKKWGGADAAICVA
VSPKAFEQAYRSLRRGGRLVFVALPADNYIQLPIFETVLNGIHVIGSIVGTRADLAETFA
LHAAGKTRVLFETRALDQVNEAFKDVEHGRNKAPRIVFSEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgaaggccgccgttgtccacgacttccatcaaccgttgcgtatcgaggaa
ttacccaagcctgagccaggattcggcgagattgtggtcaagatcgaagcgtcaggtcta
tgtcacaccgatatccacgcggcgcacggtgactggcccgtgaaacccaaactcccgttt
attccggggcacgaaggggtaggtattgtcgaaagcgtcggagcgggtgtcaccaacgtg
aaggaaggcgaccgcgtggcaattccctggttgggttatgcctgcggcgattgcaaatac
tgcgcttcaggttgggaaacgctctgcgaacgtcagttgaataccggttatttcctcgat
ggcgcctatgcccagtatgctaaggcctatgcgaagtacgtgggcatcgttcctgcgggt
gtttctgcactcgatgccgcgccgctgacctgcgccggcgtcacgacgtacaaagcggtg
aaggtttccggggcgcgcccttcggagttggtggccgtctttggcgtcggcggattgggg
cacctggcgttacagtatgccaaaattgccggggcaacggtggcagcgatcgacctgctc
gatgagcggttgcagacggcgcgcgaactcggcgccgatattacgatcaacgccagcacg
catgatccggtcgaagaattgaagaaatggggcggcgccgatgccgcgatctgcgtggcc
gtctcgccgaaggcgttcgagcaagcctaccgatcattgcgacgcggcgggcgactggtg
ttcgtggcacttcctgccgataactacatccagttgcctatcttcgagacggtgctcaac
ggcatccacgtcatcggctcgattgtcggcacccgcgcagacctggcggaaacgtttgca
ttgcatgccgccggaaagacgcgcgtcctctttgaaacgcgcgcgctcgatcaggtgaac
gaggcgttcaaggatgtcgagcatggacgcaacaaggcgccgcggatcgtcttctctgag
ttttga

DBGET integrated database retrieval system