KEGG   Roseiflexus sp. RS-1: RoseRS_0798Help
Entry
RoseRS_0798       CDS       T00542                                 

Definition
(GenBank) peptidase S1 and S6, chymotrypsin/Hap
Organism
rrs  Roseiflexus sp. RS-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_6 PDZ_2 Trypsin PDZ Peptidase_S46 Peptidase_S32 GRASP55_65
Motif
Other DBs
NCBI-ProteinID: ABQ89212
UniProt: A5URF9
Position
990700..991590
Genome map
AA seq 296 aa AA seqDB search
MTSMTQVFYRAPDIVAGFADRAERARRSVVHLHGAGRGVGTGVVWQSGGVVLTNDHVVAG
TGGRLRMQTLDGRDLPVRVAARNPDLDLALLHTSADDLPPASVGDSSRLRVGELVFAIGH
PWGQPWVVTAGIVSGLGEAETRNGQRVAFIRSDVRLAPGNSGGPLLDARGRVIGINAMVF
GGDLAVAIASHVVERWLNDSQGRRARLGVGVQSLPLPEGVLNGRSRGLLVVSLEPGSPAE
QAGILVGDLLLHADTVSLEQPEDLHRALQHTDGTLRLRLLRAGDIRVIDVTPGAGS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacttccatgactcaggtgttctatcgtgcaccggatattgttgccggtttcgctgat
cgtgccgaacgcgcgcggcggagcgtcgtgcatctgcacggagcaggcagaggcgttggt
accggcgtggtctggcaatctggcggcgttgttctgaccaacgaccacgtcgttgctggt
acgggcggcaggttgcgcatgcaaacgctcgatgggcgcgatctgccggtgagggttgca
gcgcgtaacccggacctcgacctggcgctgctccacacgtcggcagacgaccttccaccg
gcatcggttggcgattcgtcgcgtttgcgggttggtgaactggtctttgcgattggtcat
ccgtggggacagccatgggtggtgactgccggtatcgtcagtgggctgggggaggcggag
acgcgcaacggacagcgtgtcgcgttcatccgttccgatgtacggctcgcgcccggcaac
tcgggcggaccgctgctcgacgcacgcggcagggtgatcgggatcaacgcaatggtgttt
ggcggcgatctggcggttgccatcgccagtcacgtcgtcgaacggtggttgaacgatagc
caggggcgacgcgcacgtcttggcgtcggtgtgcaatcactgccattaccggaaggcgtg
ctgaacggacgatcgagaggcttgctggtagtcagtctcgagccaggcagtccggcggag
caggcggggattctggtgggcgacctgctgctccatgccgatacggtatcattggagcag
ccggaggacctgcacagagcgcttcagcacacggatggaacgctccgtctccggttgctg
cgcgctggcgacattcgcgtgatcgatgtgacgcccggcgcgggatcatag

DBGET integrated database retrieval system