KEGG   Roseiflexus sp. RS-1: RoseRS_1045
Entry
RoseRS_1045       CDS       T00542                                 

Definition
(GenBank) holo-acyl-carrier-protein synthase
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RoseRS_1045
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     RoseRS_1045
SSDB
Motif
Pfam: ACPS 4PPT_N
Other DBs
NCBI-ProteinID: ABQ89454
UniProt: A5US51
Position
complement(1284000..1284416)
AA seq 138 aa
MTVYTGIDIVEIARIKRAVERWGDRFVQRIYSPAEIALCAGRINSLAARWAAKEAVAKLL
GVGMRGPGSSAHSVAFRDIETLTDDDGRPTVTLSGAARARARELHIESICISLSHDHGLA
IAVAVASTSPAARRRMPW
NT seq 417 nt   +upstreamnt  +downstreamnt
gtgacagtctacaccggtatcgatattgtggagatagcacggatcaaacgcgcagtcgag
cgctggggcgaccgattcgtgcagcggatctattctcccgctgagattgcgctgtgcgcc
gggcggatcaattcgctggcggcgcgctgggcggcaaaggaggcggtcgccaaattgctg
ggcgtcgggatgcgtggtcctggcagcagcgcacacagcgttgcgttccgcgacatcgag
acgctcaccgacgacgacgggcgtccaactgtgacgctcagcggagcggcgcgcgcgcgc
gcccgcgaactgcacatcgagagcatctgtatcagcctgtcgcacgatcacggtctggca
attgcggtcgccgtcgcgtcgacttcacccgcagccagaaggaggatgccatggtaa

DBGET integrated database retrieval system