KEGG   Roseiflexus sp. RS-1: RoseRS_1180Help
Entry
RoseRS_1180       CDS       T00542                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RoseRS_1180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rrs03011]
    RoseRS_1180
Ribosome [BR:rrs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RoseRS_1180
  Bacteria
    RoseRS_1180
  Archaea
    RoseRS_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABQ89587
UniProt: A5USI4
Position
complement(1452291..1452632)
Genome map
AA seq 113 aa AA seqDB search
MQAKAVTKYVRISPTKVRPVMDLVRGKPVDRALAILRYLPHKAAREIARTIESARANATN
NYDMAPDALIVKYIFADEGPAFKRIMPRARGRADRIRKRTTHITVIVDDGEEM
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgaaagcagtaaccaaatatgtccgcatctcgccgacaaaggtgcgcccggtg
atggatctggtgcgcggcaagccggtcgatcgggcgctggcgatccttcgctacctgccc
cacaaagcggcgcgcgagatcgcccgcacgatcgagtcggcacgggcgaatgccaccaac
aactacgatatggcgcccgatgcgctcatcgtgaagtacatcttcgccgatgaaggtccg
gcgtttaaacggatcatgccgcgcgcccgcggtcgagccgatcgcattcgcaagcggacg
acccatatcacggtgattgtcgatgacggcgaggagatgtag

DBGET integrated database retrieval system