KEGG   Roseiflexus sp. RS-1: RoseRS_1252Help
Entry
RoseRS_1252       CDS       T00542                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01130  Biosynthesis of antibiotics
rrs01230  Biosynthesis of amino acids
Module
rrs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RoseRS_1252
Enzymes [BR:rrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RoseRS_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh ThiG B12-binding NanE
Motif
Other DBs
NCBI-ProteinID: ABQ89657
UniProt: A5USQ4
Position
1538628..1539437
Genome map
AA seq 269 aa AA seqDB search
MDTILNRILTHKRVEVERQRIKIPDAQIRARAEAAPPPRDFAAALRAHRPIALIAEVKKA
SPSKGVLIENFDPLALAHTYASNGASAISVLTDVRFFQGSLKHLEGIRAMVDRGAVPPLP
LLRKDFIIDPYQVAEARAYGADALLLIVAALDDETLAALLALTHSFGMQALVEVHNEDEL
RRALDAGASIIGVNNRDLHSFTTTLETTRRLAALLPSSNRPLLVSESGIFTAEHVALVRS
WGADAILVGEALVTAPDISSKVRELGGGS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggacacaatactcaaccgcattctgacccacaagcgtgttgaagtcgagcgacagcgc
atcaagatacccgacgcacagatccgcgcgcgggcagaagcggcgccgccgccacgcgac
ttcgccgctgcgctgcgtgcacatcgccccatcgcgctgatcgccgaggtcaagaaagca
tcgccgtcgaaaggcgtcctgatcgagaacttcgatccgctggcgctggcgcatacctat
gccagcaacggtgcatccgccatttcggtgctcaccgatgtgcgcttcttccagggcagc
ctgaagcatctggaaggaattcgcgccatggtcgatcggggagcggtgccgccattgccg
ctcctccgcaaggatttcatcatcgacccgtatcaggtcgcagaggcgcgcgcgtatggc
gccgatgcgctgctcctgatcgtcgccgcgctcgacgacgagacgctggcggcgctgctg
gcgctgacccactccttcggcatgcaggcgctggtcgaggtgcataacgaagacgaactc
cggcgcgctctggatgccggtgcatccattatcggcgtcaacaaccgtgacctgcacagt
tttacgacgaccctggagacgacccgccgcctggctgcgttgctgccatcatcgaatcgt
ccgctgctggtcagcgagagcggcatttttaccgccgaacacgtcgcactggtgcgctcg
tggggcgccgatgcaatcctggtcggtgaagcgctggtcactgcccccgatatttccagt
aaagtgcgcgaactgggaggaggctcatga

DBGET integrated database retrieval system