KEGG   Roseiflexus sp. RS-1: RoseRS_2950Help
Entry
RoseRS_2950       CDS       T00542                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00260  Glycine, serine and threonine metabolism
rrs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01130  Biosynthesis of antibiotics
rrs01230  Biosynthesis of amino acids
Module
rrs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RoseRS_2950
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RoseRS_2950
Enzymes [BR:rrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RoseRS_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABQ91315
UniProt: A5UXG2
Position
complement(3691345..3692130)
Genome map
AA seq 261 aa AA seqDB search
MSRIAETFAYLRAAGRTALMPYLMTGYPERDSALELAPALEAAGADLFELGVPFSDPLAD
GATIQRASERALANGIRLEHCIETVAGLRKRGVRAPIVPMGYYNPFLQYGLERLARDMAD
AGADGLIIPDLPPEEAHECHAACRAHGLDLIFFVAPTTPDERIDRIAALASGFIYCVALT
GVTGARRELWSGLPAFLERVRRRTSLPLVVGFGISSAAHVREAGRYAAGAIVASALINVI
EQAPPGEYVARAVDFVRSLRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtattgccgaaacctttgcctatttgcgcgccgccgggcgcacagcacttatg
ccctacctgatgaccggttacccggagcgcgactcggcgctggaacttgcacccgcgctg
gaagcggctggcgccgatctgttcgagcttggcgttccattctccgatccgctcgccgac
ggcgccacgatccagcgcgcctcggagcgcgcccttgccaacggcattcgcctggaacac
tgcatcgaaacggttgccgggttgcgcaaacgtggcgtgcgcgcgccaatcgtgccgatg
gggtattacaacccatttttgcagtacggtcttgagcggctggcacgcgatatggctgat
gctggcgcggatggactgatcattcccgacctgccgccggaagaggcgcacgagtgccac
gctgcctgccgtgcgcatggtcttgacctgatcttctttgtcgctcccaccacccctgac
gaacgaatcgaccgcatcgccgcactcgcaagcggtttcatctactgcgttgcgctgacc
ggcgtcaccggcgcgcggcgcgaactgtggagcggattacccgcgttcctcgaacgggtt
cgccgccgcaccagtctgccgctggtggtcggattcggcatcagcagtgcggcgcatgtc
cgtgaggcgggcagatatgccgccggtgcaatcgtcgccagcgcgctgatcaatgtcatc
gaacaggcgccgcccggcgagtatgttgcacgcgcagtcgatttcgtgcggtcgctgcgt
ggctga

DBGET integrated database retrieval system