KEGG   Roseiflexus sp. RS-1: RoseRS_3708Help
Entry
RoseRS_3708       CDS       T00542                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00260  Glycine, serine and threonine metabolism
rrs00630  Glyoxylate and dicarboxylate metabolism
rrs00670  One carbon pool by folate
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01130  Biosynthesis of antibiotics
rrs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RoseRS_3708
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RoseRS_3708
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RoseRS_3708
Enzymes [BR:rrs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     RoseRS_3708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ABQ92062
UniProt: A5UZK9
Position
4641221..4642195
Genome map
AA seq 324 aa AA seqDB search
MELCMDRDMYASALERAVIADERTAGRIFMRGRDRAALLHRLSTNDIERLKPGEGTLTVL
TTPIGRIIDLLTVHALNDALLIVTSPDQGPPVFGHLRRNIFFNDQVTLDAAGRTHAQLAL
YGPQAARLIAELTGAAIDLPLHGITTTAIAGVSLLIARRKPIGGDSFTLYVPSDGYDAVQ
AALLAAGATPIDGDTLDVLRIERGYGAFGRELSQEYIPLETGLLDAVSFSKGCYVGQEII
ARMESRGRLAKRLCGLQLSQPVASPAKLVCDGRDAGDLTSAAVSPRFGPIALAYVRTVYA
EPGTVVGVEGTGVTGRVVELPFAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagctctgcatggatcgagatatgtatgccagcgcattggagcgtgctgttatcgct
gatgagcgcactgccggacggatctttatgcgcggacgcgaccgcgcggcgctgctccat
cgcctctcaaccaacgacatcgaacgactgaagccgggtgaagggacgctgaccgtcctc
acaaccccgattgggcggatcatcgatctgctgaccgtccacgcattgaacgatgcgctg
ctgatcgtgaccagtcccgatcagggaccgccggtgttcgggcatttgcgccgcaacatc
tttttcaatgaccaggtgaccctggacgcagccgggcgcacccacgcgcaactggcgttg
tatggaccgcaggcggctcgcctgattgcagaactgaccggtgctgccattgacctgcca
ctccatggtatcacgacaactgccattgcgggggtcagtctgctgatagcgcgccgcaag
ccgattggcggtgacagttttacgctgtatgttccgtccgacgggtatgatgccgtccag
gctgcgctccttgccgctggtgcaacgccgatcgacggcgacacgctcgatgtgctgcgg
atcgaacggggatacggcgcattcgggcgcgagttgagtcaggagtatattccgctggaa
accggcttgctggatgcagtcagtttcagcaaaggatgttacgtcggtcaggaaatcatc
gcgcggatggagagtcgcggtcgcctggcgaagcgcctgtgtggtctccaattgagtcaa
ccggttgcctcgcccgcgaaactggtctgtgacggcagagatgccggtgatctcaccagt
gctgcggtatcgccacggttcggtcccatcgcgctggcatatgtgcgtacagtgtatgct
gaaccgggaacagttgttggagtggaagggaccggagtaacaggcagagtagtcgaactg
ccgtttgcggcgtaa

DBGET integrated database retrieval system