KEGG   Roseiflexus sp. RS-1: RoseRS_3804Help
Entry
RoseRS_3804       CDS       T00542                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00240  Pyrimidine metabolism
rrs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RoseRS_3804
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RoseRS_3804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK CoA_binding AAA_30 hnRNP_Q_AcD AAA_22
Motif
Other DBs
NCBI-ProteinID: ABQ92158
UniProt: A5UZV5
Position
complement(4758847..4759428)
Genome map
AA seq 193 aa AA seqDB search
MTRLLGGRIEVICGCMFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRYRLGSLVSHNGL
SVEARVIDSIRDIPAYLDSDVDVVAVDELHLLDDPPDAAREVCQQLADRGLRVIVAGLDQ
DFRAQPFPAMAQLMAVAEQVDKLYAICVRCGAYATRSQRLIDGKPAPADAPTIVVGGQEL
YEARCRACYEPAQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcctgttggggggccgcattgaggtgatctgcggctgtatgttcagcggtaag
accgaagaactgatccgccgtctcaaccatgtccggcttgcacgtcagcgcctgatcgcc
tttacgccacgccgcgatacgcgctaccggctcggcagcctggtgagtcacaatggtctc
tcggtcgaagcgcgcgtgatcgactcgatccgcgatattccggcgtaccttgatagcgat
gtcgatgtggtggcggtcgatgaactgcacctgctcgatgatccgcccgatgcggcgcgc
gaggtctgccagcaactggcagaccgtggcttgcgggtcatcgtcgccgggctggatcag
gactttcgcgcgcagccgttcccggcaatggcacagttgatggcagtggctgaacaggtc
gacaagttgtacgcaatctgcgtgcggtgcggcgcctatgcgacccgttcccaacgcctg
atcgacggcaaaccggcgcctgccgacgcgccgacgattgttgtcggcgggcaggaactg
tacgaagcgcgctgccgtgcctgctacgaaccggcacagtaa

DBGET integrated database retrieval system