KEGG   Rhodococcus rhodochrous: 4535765_02676Help
Entry
4535765_02676     CDS       T05521                                 

Gene name
bsaA_2
Definition
(GenBank) thiol peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt00480  Glutathione metabolism
rrt00590  Arachidonic acid metabolism
rrt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4535765_02676 (bsaA_2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4535765_02676 (bsaA_2)
Enzymes [BR:rrt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4535765_02676 (bsaA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: SNV20185
Position
1:2865049..2865582
Genome map
AA seq 177 aa AA seqDB search
MSVHEYTVATADGGSEDLARFAGRYLLIVNVASKCGLTPQYEALEALHRELGERGLQILA
FPCNQFGGQEPGSDSEIQEFCRVNFDVTFPVFAKLDVNGDDAHPLYRYLRAEAPGDFGPQ
HGFLFEHVSKTRPEALGTDEVKWNFTKFLVDPQGAVVRRFEPTVTPEEIGKELADLL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcacgagtacaccgtggccaccgccgacggcggcagcgaggatctcgcccgc
ttcgccggccggtacctgctgatcgtcaatgtcgccagcaagtgcggcctgaccccgcag
tacgaggcgctcgaagcgctgcaccgcgaactgggtgagcgcggcctgcagatcctcgcg
ttcccgtgcaaccagttcggtggtcaggaaccgggcagcgacagtgagatccaggagttc
tgccgggtgaacttcgacgtcaccttcccggtgttcgcgaagctcgacgtaaacggcgac
gacgcacacccgctctaccggtacctgcgcgccgaggctcccggcgatttcgggccgcag
cacggtttcctgttcgagcacgtgagcaagacccgcccggaggcgctcggcaccgacgag
gtgaaatggaacttcaccaagttcctcgtcgacccgcagggcgcggtggtgcgccgcttc
gagccgacggtcacccccgaggagatcggcaaggaactcgccgacctgctctga

DBGET integrated database retrieval system