KEGG   Rhodococcus rhodochrous: 4535765_03658Help
Entry
4535765_03658     CDS       T05521                                 

Gene name
pitA
Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rrt  Rhodococcus rhodochrous
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    4535765_03658 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 UPF0767
Motif
Other DBs
NCBI-ProteinID: SNV23220
Position
1:3957969..3959150
Genome map
AA seq 393 aa AA seqDB search
MTAEFVVLLVVVVTALAFDFTNGFHDTGNAMATSIATGALKPKTAVTLSATLNLVGAFLS
VEVAATVAKGVVDLDTVGGTDLLLIVFAGLVGAILWNISTWLFGLPSSSSHALFGGLVGA
ALASIGVQGVVWDGVLGKVLIPAVLAPVIAALVSTVGIWSMHRLTRSVSNEHRDRGFRLG
QIGTASLMSLAHGTNDAQKTMGVIFLALVAHGTITADTDMPFWVKVACAVAIALGTYLGG
WRIIRTLGKGLVEIAPPQGLAAESSSAAIILTSSHFGLPLSTTHVATGSILGTGLGTKGA
EVRWSVARRMVVAWVITLPCAAVVGAICWGLAHLIGGMPGVLVVFAILCALAVFMWLRSR
RQPVDASNVTADWDDKLAPAPGASETVTGEGRS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagagttcgtcgtgctcctggtggtggtcgtcactgccctcgcattcgatttc
accaacggcttccacgacaccggcaatgccatggcgacatccatcgccaccggcgccctc
aaacccaaaaccgcggtcactttgtccgcgaccctcaacctcgtcggcgccttcctgtcc
gtggaagtcgccgcgaccgtcgcgaagggtgtcgtcgacctcgacaccgtcggcggtacc
gatctgttgctcatcgtcttcgccggtctggtcggagcgatcctctggaacatctcgacc
tggctgttcggcctgccgtccagctcgtcgcacgccctgttcggcggtctcgtcggcgct
gcactggcgtcgatcggtgtccagggcgtggtgtgggacggagtgctgggcaaggtcctg
atccccgccgtgctcgcgcccgtcatcgcggcgctggtgtccacggtgggcatctggtcg
atgcaccgcctgacccgctccgtctccaacgaacaccgcgaccgcggcttccggctggga
cagatcggcacggcgtccctgatgtccctcgcgcacggcaccaacgacgcgcagaagacg
atgggcgtgatcttcctggccctcgtcgcccacggcaccatcaccgccgacacggacatg
ccgttctgggtgaaggtcgcctgtgccgtcgcgatcgcactcggcacctatctcggcggc
tggcgcatcatccgcacgctgggcaagggtctcgtcgagatcgccccgccgcagggcctg
gccgccgagtcgtcgtcggccgccatcatcctcacctcgagccatttcggtctgccgctg
tcgaccacgcacgtcgccacgggctcgatcctcggcacgggtctgggcaccaagggcgcc
gaggtgcgctggtcggtggcgcgacggatggtcgtcgcgtgggtcatcaccctgccgtgc
gccgcggtcgtcggagcgatctgctgggggctcgcccacctcatcggcggcatgcccggc
gtgctcgtcgtgttcgcgatcctgtgcgccctggccgtgttcatgtggctgcgctcgcgc
cggcagcccgtcgacgcctccaacgtcaccgccgactgggacgacaagctcgccccggcg
ccgggtgcctccgaaacggtcaccggggaaggacgctcgtga

DBGET integrated database retrieval system