KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3000
Entry
Rru_A3000         CDS       T00310                                 

Name
(GenBank) Formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00620  Pyruvate metabolism
rru00640  Propanoate metabolism
rru00650  Butanoate metabolism
rru01100  Metabolic pathways
rru01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rru_A3000
   00640 Propanoate metabolism
    Rru_A3000
   00650 Butanoate metabolism
    Rru_A3000
Enzymes [BR:rru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Rru_A3000
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABC23795
UniProt: Q2RQ00
Position
complement(3454293..3456551)
AA seq 752 aa
MSIVQKDIPATNPWKGFTEGPWQTGIDVRDFIQKNVTPYQGDGAFLAGPTDRTRLLWEKL
SALLLKEREKGVLDVSADRASSITAHDAGYIDRDAEIIVGLQTDAPLKRAIMPNGGLRMV
QSGLEAYGFASDPTVNEVWTKYRKSHNQGIFDVYSPDVLAARKSGVITGLPDAYGRGRII
GDYRRVALYGVDFLRDQKQMEFHELDDAVFSEDVIRLREELSEQWRALDELKQMAAKYGH
GIGRPAANAREAIQWTYFAYLAAVKEQNGAAMSLGRVSSFLDIYIQRDIEAGLLSEDGAQ
EMIDDLVIKLRIVRFLRTPDYDQLFSGDPTWVTECVGGMAEDGRTLVTRNSFRFLNTLYN
LGPAPEPNLTVLWSTALPQSFKTFCAKVSADTSAIQYENDDLMRRRWGDDYGIACCVSAM
RIGKQMQFFGARANLAKALLYAINGGVDEKSGQVVAKGFAPITADVLDYDEVMAKLDKTM
DWLAQTYVKALNTIHYMHDKYAYERIEMALHDRDILRTMACGIAGLSVAADSLSAIKFAK
VHVVRDDKGLAVDYTIEGDYPAYGNNDDRADSIAVWLTETFMEKVRAQPRFYRDAMPTQS
VLTITSNVVYGKKTGNTPDGRRAGEPFAPGANPMNGRDVKGFVASGASVAKLPYAAALDG
ISWTASATPDSLGRTDEERAVNLSNCLDAFATAGGFHVNVNVFNRDTLLHAMDHPELYPQ
LTIRVSGYAVNFVKLTREQQLDVIGRTFHQTM
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgagtatcgtgcaaaaggacattcccgccaccaacccctggaaaggctttaccgagggc
ccgtggcagaccggcatcgatgtccgtgatttcatccagaaaaacgtgaccccctatcag
ggtgacggcgccttcctggccgggccgaccgaccgaacccgcctgttgtgggaaaaactg
tccgcgctgttgctcaaggagcgcgagaagggggtgcttgacgtttcggccgaccgcgcc
tcgtcgatcaccgcccatgacgccggctatatcgaccgcgacgccgagatcatcgtcggc
ctgcagaccgacgccccgctcaagcgcgccatcatgcccaacggcggcctgcgcatggtt
caaagcggcctggaggcctatggcttcgccagcgatcccaccgtcaacgaggtgtggacc
aaataccgcaaaagccacaaccagggcatcttcgacgtttacagccccgatgttctggcc
gcccgcaaatcgggcgtgatcaccggcctgcccgacgcctatggccggggccgcatcatc
ggcgactatcgccgcgtcgccctctatggcgtcgatttcctgcgcgaccagaagcaaatg
gaattccacgagcttgatgacgcggtgttcagcgaggacgtcatccgcctgcgcgaggaa
ctgtccgagcagtggcgggcgctcgatgagctcaagcagatggcggccaaatacggccat
ggcatcggtcgcccagcggccaatgcccgcgaagccatccagtggacctatttcgcctat
ctggcggcggtcaaggagcagaacggcgcggcgatgtcgctgggccgggtgtcgagcttc
cttgatatctacatccagcgcgatatcgaagccggccttctcagcgaagacggcgcccag
gagatgatcgacgatctagtgatcaagctgcgcatcgtccgcttcctgcgcaccccggac
tacgatcagctgttctcgggcgatccgacctgggtcaccgaatgcgtcggcggcatggcc
gaggatggccgtaccctggtcacccgcaacagcttccgcttcctcaataccctttacaac
ctgggtccggcccccgagcccaatctgaccgtgctgtggagcacggccctgccgcagagc
ttcaagaccttctgcgccaaggtttcggccgataccagcgccattcaatacgagaatgac
gacctgatgcgccggcgctggggcgatgattacggcatcgcctgctgcgtgtcggccatg
cgcatcggcaagcagatgcagttcttcggcgcccgcgccaatctggccaaggccctgctc
tacgccatcaacggcggcgtcgatgaaaaatccggtcaggtggtggccaagggcttcgcg
ccgatcaccgccgatgtcctcgactatgacgaggtgatggccaagctcgacaagaccatg
gactggctggcccagacctatgtcaaggcgctcaacaccatccactacatgcacgacaaa
tacgcctatgagcggatcgagatggcgctgcatgaccgcgacatcctgcgcaccatggcc
tgcggcatcgccgggctgtcggtggcggccgattcgctttcggccatcaagttcgccaag
gtccatgtcgtgcgcgacgacaaggggctggccgtcgattacacgatcgagggcgactat
cccgcctatggcaacaacgacgaccgcgccgattccatcgccgtctggctgaccgaaacc
ttcatggaaaaggtccgcgcccagccgcgcttctaccgcgacgcgatgccgacccaatcg
gttctgaccatcacctcgaacgtggtttacggcaagaagaccggcaacacccccgacggc
cgccgcgccggcgagcccttcgcgccgggtgccaacccgatgaacggccgcgatgtcaaa
ggcttcgtcgcctcgggcgcctcggtcgccaagctgccctatgccgccgccctcgatggc
atcagctggaccgcgtcggccaccccggattcgctcggacgcaccgacgaggagcgggcg
gtcaatctgtcgaattgcctggacgccttcgccaccgccggcggcttccacgtcaacgtc
aacgtcttcaaccgcgacaccttgctccacgccatggaccacccggagctttacccgcag
ttgaccatccgcgtgtcgggctacgccgtgaatttcgtcaagctgacccgtgaacagcag
ctcgacgttatcggccgcaccttccaccagaccatgtga

DBGET integrated database retrieval system