KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0356Help
Entry
Rru_A0356         CDS       T00310                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00020  Citrate cycle (TCA cycle)
rru00480  Glutathione metabolism
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
rru01210  2-Oxocarboxylic acid metabolism
rru01230  Biosynthesis of amino acids
Module
rru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rru_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rru_A0356
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rru_A0356
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Rru_A0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-GeneID: 3834643
NCBI-ProteinID: YP_425448
UniProt: Q2RXI4
Position
complement(430719..431936)
Genome map
AA seq 405 aa AA seqDB search
MSKITVKNPIVELDGDEMTRIIWQFIKEKLILPYLDVDLLYYDLGVEKRDETEDRITIEA
ANAIKKHHVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILDGTVFREPIICKNVPRL
VPGWTQPIVIGRHAFGDQYKATDFIVPGAGTLTMSFKPEDGGPAQEYEVFKFPGAGVAMG
MYNLDDSIRGFARACLNYGILRNWPVYLSTKNTILKAYDGRFKDLFQEVFDAEFAERFKA
KGITYEHRLIDDMVACCMKWSGGFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGE
TVEAEAAHGTVTRHYRLHQKGKETSTNPIASIFAWTRGLKFRGEFDGTPDVVQFAEALER
VCVETVEAGFMTKDLAILIGPDQPWLTTTQFLDKLDATLKAEMKS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcacggtaaagaatcccatcgtcgaactcgacggcgatgaaatgactcgt
atcatttggcagttcattaaagaaaagctgatccttccctatctcgacgtcgatcttctt
tattacgacctgggggtcgagaagcgcgacgagaccgaagaccgcatcaccatcgaagcc
gccaatgccatcaaaaagcatcatgtcggcgtgaaatgcgcgaccatcacccccgacgag
gcccgcgtcgaggagttcggcctgaagaagatgtggaagtcgcccaatggcaccatccgc
aatattctcgatggcaccgtcttccgcgagccgatcatctgcaagaacgtgccgcgtctg
gtgcccggctggacccagcccatcgtcatcggccgtcacgcctttggcgaccagtacaag
gcgacggatttcatcgttcccggcgccggcaccctgacgatgagcttcaagcccgaggac
ggcggtccggcccaggagtacgaggtgttcaaattcccgggcgccggcgtggccatgggc
atgtacaacctcgacgactcgatccgcggcttcgcccgcgcctgcctgaactacggcatc
ctgcgcaactggccggtctatctgtcgaccaagaacaccatcctcaaagcctatgacggc
cgcttcaaggatctgttccaggaggtcttcgacgccgaattcgccgagcgcttcaaggcc
aagggcatcacctatgagcatcgcctgatcgatgacatggtcgcctgctgcatgaagtgg
tcgggcggcttcgtctgggcttgcaagaactatgacggcgacgtgcagtccgacaccgtg
gcccagggcttcggctcgcttggcctgatgacctcggtgctgatgacccccgatggcgag
acggtggaggccgaggccgcccacggcacggtgacccgccattaccgcctgcaccagaag
ggcaaggagacctcgaccaatcccatcgcctcgatcttcgcctggacgcgcggattgaag
ttccgcggcgagttcgacggcacccccgatgtggtgcaattcgccgaggccctggagcgg
gtttgcgtggaaaccgtggaagccggcttcatgaccaaggatctggcgatcctgatcggg
cccgaccagccctggctgaccaccacccagttccttgacaagctcgacgccaccttgaag
gcggaaatgaagagctga

DBGET integrated database retrieval system