KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1185
Entry
Rru_A1185         CDS       T00310                                 

Definition
(GenBank) SSU ribosomal protein S16P
  KO
K02959  small subunit ribosomal protein S16
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rru_A1185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rru03011]
    Rru_A1185
   03029 Mitochondrial biogenesis [BR:rru03029]
    Rru_A1185
Ribosome [BR:rru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Rru_A1185
  Bacteria
    Rru_A1185
Mitochondrial biogenesis [BR:rru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rru_A1185
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: ABC21986
UniProt: Q2RV59
Position
1403752..1404126
AA seq 124 aa
MSLRIRLARGGAKKRPFYRIVVADSRSPRDGRFIEKLGTFDPMLPRDHERRVVLKDERVK
YWLGVGALPSDRVARFLGLSGLTEARKVPEQTKQAQPKAKAQERLREAEEKARAAAEAAA
SAEG
NT seq 375 nt   +upstreamnt  +downstreamnt
atgtccctgcgaattcggcttgcccgcggcggcgccaagaagcgccccttctaccgcatc
gtggtggcggattcccgctcgccgcgtgatggtcgcttcatcgagaagctgggcaccttc
gatccgatgctgccgcgtgaccacgagcgccgcgtcgttctcaaggacgagcgcgtgaag
tactggctgggcgttggcgccctgccgtccgatcgcgtcgcccggttccttggcctgtcc
ggcctgaccgaggcccgcaaggtccccgagcagaccaagcaggcccagcccaaggccaag
gcccaggagcgtctgcgcgaggccgaggaaaaggcccgtgccgccgccgaagccgcggcg
agcgccgaaggctga

DBGET integrated database retrieval system