KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1185
Entry
Rru_A1185         CDS       T00310                                 

Gene name
rpsP
Definition
(RefSeq) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rru_A1185 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rru03011]
    Rru_A1185 (rpsP)
   03029 Mitochondrial biogenesis [BR:rru03029]
    Rru_A1185 (rpsP)
Ribosome [BR:rru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Rru_A1185 (rpsP)
  Bacteria
    Rru_A1185 (rpsP)
Mitochondrial biogenesis [BR:rru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rru_A1185 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 3834695
NCBI-ProteinID: YP_426273
UniProt: Q2RV59
Position
1403752..1404126
AA seq 124 aa
MSLRIRLARGGAKKRPFYRIVVADSRSPRDGRFIEKLGTFDPMLPRDHERRVVLKDERVK
YWLGVGALPSDRVARFLGLSGLTEARKVPEQTKQAQPKAKAQERLREAEEKARAAAEAAA
SAEG
NT seq 375 nt   +upstreamnt  +downstreamnt
atgtccctgcgaattcggcttgcccgcggcggcgccaagaagcgccccttctaccgcatc
gtggtggcggattcccgctcgccgcgtgatggtcgcttcatcgagaagctgggcaccttc
gatccgatgctgccgcgtgaccacgagcgccgcgtcgttctcaaggacgagcgcgtgaag
tactggctgggcgttggcgccctgccgtccgatcgcgtcgcccggttccttggcctgtcc
ggcctgaccgaggcccgcaaggtccccgagcagaccaagcaggcccagcccaaggccaag
gcccaggagcgtctgcgcgaggccgaggaaaaggcccgtgccgccgccgaagccgcggcg
agcgccgaaggctga

DBGET integrated database retrieval system