KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1203Help
Entry
Rru_A1203         CDS       T00310                                 

Definition
(RefSeq) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00020  Citrate cycle (TCA cycle)
rru00190  Oxidative phosphorylation
rru00650  Butanoate metabolism
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
Module
rru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rru_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rru_A1203
   00650 Butanoate metabolism
    Rru_A1203
  Energy metabolism
   00190 Oxidative phosphorylation
    Rru_A1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 3833701
NCBI-ProteinID: YP_426291
UniProt: Q2RV41
Position
1420403..1420789
Genome map
AA seq 128 aa AA seqDB search
MSLRSPLGRARGLGSAKAGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAF
MAVPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVS
ILKLTFGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtccctacgctctccgctcggccgcgcgcgcggcctgggttccgccaaggcgggtgcc
gccaatcactggatggccgagcgccttccggccatcgccttggtgccgctggcgctgtgg
ttcgttttcgtcgccatcatcagcaatctgggggcgagctacgcccagattcaggctttc
atggcggtgccgttgaacgccaccttgatgctgctgacggtgttctgcgcctttttccac
ggcgcgctcggcctgatcgtgattattgaagattacgtccaaaatcacgccgtcaagaac
gctttggtcttcggaaccaagctctacgccttgttcggtgccgttctggccgccgtctcc
atcctcaagctgactttcgggggctaa

DBGET integrated database retrieval system