KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1394Help
Entry
Rru_A1394         CDS       T00310                                 

Definition
(RefSeq) nitrogenase iron-iron protein, alpha chain
  KO
K02586  nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00625  Chloroalkane and chloroalkene degradation
rru00910  Nitrogen metabolism
rru01100  Metabolic pathways
rru01120  Microbial metabolism in diverse environments
Module
rru_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Rru_A1394
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rru_A1394
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     Rru_A1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 3834809
NCBI-ProteinID: YP_426482
UniProt: Q2RUK0
Position
complement(1645052..1646611)
Genome map
AA seq 519 aa AA seqDB search
MPHHTFKCSECIPERTKHAVIKGADEDLTSCLPLGYLNTIPGSISERGCAYCGAKHVIGQ
PMKDVIHISHGPIGCTYDTWQTKRYISDNNNFQLKYTYATDVREKHIVFGAEKLLKQNIL
EAFKAFPDIKRMTIYQTCATALIGDDIDAIASEVMDELPDVDIFVCNSPGFAGPSQSGGH
HKINIAWVNQKVGTVEPEITSDYVINYVGEYNIQGDQEVMQDYFNRMGIQILSTFTGNGS
YDGLRAMHRAHLNVLECARSAEYICNELRVRYGIPRLDIDGFGFEPLSDSLRKIGLFFGI
EDRAQAIIDEETAKWKPQLDWYKERLRGKKVCLWPGGSKLWHWAHVIQEEMGLNVVSLYT
KFGHQGDMEKGIARCGEGALAIDDPNELEGLEALEMLKPDIILTGKRPGEVAKKVRVPYL
NAHAYHNGPYKGYEGWVRFARDIYNAIYSPIFQLSALDISKDPIPTDQGFLTPQMISDPA
LPAEVRSSTVLTPYRGAYDTISALREKTYPRFDAVPVAQ
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccataccttcaaatgcagcgaatgcatccccgagcgcaccaagcacgcggtg
atcaagggcgccgacgaggacctgacctcgtgcctgccgctgggttatctcaataccatt
ccgggatcgatctccgagcgcggctgcgcctattgcggcgccaagcacgtgatcggccag
ccgatgaaggacgtcatccatatcagtcacggaccgatcggatgcacctacgacacctgg
cagaccaagcgttatatcagcgataacaacaacttccagctcaagtacacctatgccacc
gatgttcgggaaaagcacatcgtctttggcgccgagaagcttctcaagcagaacatcctc
gaagccttcaaggcgtttcccgacatcaagcgcatgaccatctaccagacctgcgccacg
gcgctgatcggcgatgacatcgacgccatcgcctcggaagtgatggacgagttgcccgat
gtcgacatcttcgtctgcaactcgccgggcttcgccgggcccagccagtcgggcggccac
cacaagatcaatatcgcctgggtcaaccagaaggtcggcaccgtcgagcccgagatcacc
agcgattacgtcatcaactatgttggtgagtataatatccagggcgatcaggaagttatg
caggattacttcaatcgcatgggcatccagatcctgtcgaccttcaccggcaacggatcc
tatgacggcctgcgggcgatgcaccgcgcccatctcaatgtgctcgaatgcgcccgttcg
gccgaatacatctgcaatgaattgcgcgtgcgctatggcatcccgcgccttgatatcgac
ggcttcggcttcgaaccgctgtcggactcgctgcgcaagatcggcctgttcttcggcatc
gaagaccgcgcccaggcgatcatcgacgaagaaaccgccaagtggaaaccccagcttgat
tggtacaaggaacgcctgcgcggcaagaaggtctgcctgtggccgggcggctccaagctt
tggcattgggcccatgtcatccaggaggaaatgggcctcaacgtcgtgtcgctctacacc
aaattcggccatcagggcgatatggaaaagggcatcgcgcgctgcggcgaaggcgccctg
gccatcgacgatcccaacgagcttgaaggcctggaagccctggagatgctcaagcccgac
atcatcttgacgggcaagcgcccgggcgaggtcgccaagaaagtgcgcgttccctatctc
aacgcccacgcctatcacaacggcccctataagggctacgagggctgggtgcgcttcgcc
cgcgatatctacaacgccatctattcgccgatcttccagctgtcggccctcgatatcagc
aaggacccgatcccgaccgaccagggcttcctgacgccgcagatgatctccgatccggcc
ctgcccgccgaggtgcggtcttcgaccgtgctgaccccctatcgcggcgcttacgacacc
atttccgccctgcgcgagaagacctatccgcgcttcgatgccgttcctgtcgcccaataa

DBGET integrated database retrieval system