KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1469Help
Entry
Rru_A1469         CDS       T00310                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00071  Fatty acid degradation
rru00072  Synthesis and degradation of ketone bodies
rru00280  Valine, leucine and isoleucine degradation
rru00310  Lysine degradation
rru00362  Benzoate degradation
rru00380  Tryptophan metabolism
rru00620  Pyruvate metabolism
rru00630  Glyoxylate and dicarboxylate metabolism
rru00640  Propanoate metabolism
rru00650  Butanoate metabolism
rru00900  Terpenoid backbone biosynthesis
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
rru01212  Fatty acid metabolism
rru02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rru_A1469
   00630 Glyoxylate and dicarboxylate metabolism
    Rru_A1469
   00640 Propanoate metabolism
    Rru_A1469
   00650 Butanoate metabolism
    Rru_A1469
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rru_A1469
   00072 Synthesis and degradation of ketone bodies
    Rru_A1469
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rru_A1469
   00310 Lysine degradation
    Rru_A1469
   00380 Tryptophan metabolism
    Rru_A1469
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rru_A1469
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rru_A1469
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rru_A1469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rru04147]
    Rru_A1469
Enzymes [BR:rru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rru_A1469
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rru_A1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 3834884
NCBI-ProteinID: YP_426557
UniProt: Q2RUC5
Position
complement(1736050..1737225)
Genome map
AA seq 391 aa AA seqDB search
MNDIVIAAAARTAVGAFTGSLSSLPAHSLGASVITDLLTRGKIAAGEIDDVLLGQVLTAA
QGQNPARQAAIAAGLPASSTALTINQVCGSGLRAVALGAQAIACGDAEVVIAGGQESMSL
APHAVLLRAGVKMGPAEMVDTMIKDGLWEAFHGYHMGITAETVAQAFGIDRATQDAFALA
SQQKAAAAQREGRFVDEIVAVCVRSRKGEVLVDSDEHLKPDTTAQSLAKLRPAFTKDGTV
TAGNASGLNDGAAGVLLMSAENAAKRGVTPLARVVSWATAGVDPAVMGTGPIPASRKALA
KAGWTIDDLDLIEANEAFAAQAIAVNREMGWDTAKVNVNGGAIAIGHPIGASGARILVSL
LHEMTRRDAKKALATLCIGGGMGIALCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatcgtcatcgccgccgccgcgcgcaccgccgtcggcgccttcaccgggtct
ttgtccagccttcccgcccatagcctgggcgccagcgtcatcaccgacctgctcacgcgc
ggcaagatcgccgccggcgagatcgacgacgtgctgcttggtcaggtcctgaccgccgcc
cagggccagaacccggcccgccaagccgccatcgccgccggactgccggcgtcaagcacc
gccttgacgatcaatcaggtctgcggttcggggctgcgcgccgtcgcccttggcgcccag
gccatcgcctgcggcgatgccgaggtggtgatcgccggcgggcaggaatcgatgagcctc
gccccccacgccgtcttgctgcgcgccggggtgaaaatggggccggccgaaatggtcgac
accatgatcaaggacggcctgtgggaggccttccacggctatcacatgggcatcaccgcc
gaaaccgtcgcccaggccttcggcatcgaccgcgccacccaggacgccttcgccctcgcc
tcgcagcaaaaagccgccgccgcccagcgcgagggacgcttcgtcgacgagatcgttgcg
gtctgcgtgcgcagccgcaagggcgaggtcctggtcgacagcgatgagcacctgaagccc
gataccaccgcccagagcctggccaaactgcgcccggccttcaccaaggatggcacggtc
accgccggcaacgcctcggggcttaacgacggcgccgccggggttttgctgatgagcgcc
gaaaacgccgccaaacgcggggtgacgccgcttgcccgcgtcgtatcctgggccaccgcc
ggcgtcgatcccgccgtgatgggcaccgggccgatcccggcctcgcgcaaggccctggcc
aaggccggctggaccatcgacgacctggatctgatcgaggccaacgaggctttcgccgcc
caggcgatcgccgtcaaccgcgagatgggctgggataccgcgaaggtcaacgtcaatggc
ggcgccatcgccatcggccatcccatcggcgcctcgggcgcgcgcatcctggtcagcctg
ctccatgaaatgacccggcgtgacgcgaaaaaggccctggcgacgctgtgcatcggcggc
ggcatgggcatcgcgctctgcgtcgaacggccctaa

DBGET integrated database retrieval system