KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1482Help
Entry
Rru_A1482         CDS       T00310                                 

Definition
(RefSeq) UDP-phosphate galactosephosphotransferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
KEGG Orthology (KO) [BR:rru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rru01005]
    Rru_A1482
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     Rru_A1482
Lipopolysaccharide biosynthesis proteins [BR:rru01005]
 O-antigen
  Rru_A1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3 MARVEL
Motif
Other DBs
NCBI-GeneID: 3834897
NCBI-ProteinID: YP_426570
UniProt: Q2RUB2
Position
1748483..1749841
Genome map
AA seq 452 aa AA seqDB search
MMDGSASGYRRIGEGRVAVAMIGVRALDLMILALGCLIGYGLRHGTPMMPEPYWAALIIA
AFVFQGAGGGLGLYSRRRPGPLPSQLAAVLLSLVATFLVLFALAYLGKVSQEFSRSWAVT
WFFIAVCAMTALRVGVARVGTLAPLWRARAVLLAADGDTGLLARLAADEGRRVDIVACLD
PVRDGARLARHCEEAKADVVFVAVPPAGIDDALRRRLRDLPLRICLLIDPPIADHPLVGP
PEIIAGAISVELYPPVLEGGGALIKRLEDLVLGALLVVVLSPLMVLVALVVRLEGAGPVL
FCQKRFGFRGEVFTIFKFRTLVEAAGETQVGRDDPRVTRVGRLLRRLSLDELPQLFNVLK
GDMSLVGPRPHALAHDEDFAATVDIYAQRRKMKPGMTGWAQVHGCRGEIRSPQDLERRVA
YDLAYLDHWSLGLDLWILALTPLRLIRDPNAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggatcggcatcggggtatcggcggatcggcgagggccgcgtcgcggtggcg
atgatcggggtgcgcgcccttgatctgatgattttggctcttggctgcctgatcggctat
ggcctgcgccatggcacgccgatgatgcccgaaccctattgggcggcgctgatcatcgcc
gccttcgttttccaaggcgccgggggtggcctcggtctttattcccggcgtcgtcccggg
cccttgccctcgcaattggcggcggtgctgctcagcctcgtggcgactttcctggtgctc
ttcgccctcgcctatctcggcaaggtctcccaggagttttcgcgaagctgggcggtgacg
tggtttttcatcgccgtctgcgcgatgacggcgctgcgggtgggggtggcccgggtgggg
acccttgcccccctgtggcgcgcccgcgccgttctactggccgccgatggcgacaccggt
ctcctcgcccggctggccgccgatgaggggcgacgcgtcgatatcgtggcctgtctcgat
cctgttcgcgacggggcgcggttggcgcgccattgcgaggaggccaaggccgatgtggtg
ttcgtcgccgtgccgcccgcggggatcgatgacgccttgcggcggcgtctgcgcgatctg
cccttgcgcatctgtctgctgattgatccgcccatcgccgatcatcccctggtcggcccc
ccggaaatcatcgccggggcgatcagcgtcgagctgtatccccccgttctcgaaggcggc
ggcgccctgatcaaacgcctcgaggatctggtgctgggcgcgcttctggtggtggtcctc
agcccgctgatggtcctggtggctttggtcgttcgtcttgagggggcggggccggtgctg
ttttgccagaagcgcttcggctttcgcggcgaggttttcaccatcttcaagttccgcacc
ctggtcgaagcggcgggggagacccaggtggggcgcgatgatccccgggtaacccgggtc
ggccggctgctgcgtcgcctcagccttgatgaattgccccagcttttcaatgtgctgaag
ggtgatatgtcgctggtcggcccgcgtccccacgccctggcccatgacgaggatttcgcc
gccaccgtcgatatctacgcccagcgccgcaagatgaagccggggatgaccggctgggcc
caggttcatggctgccggggggagatccgctccccccaggacctggaacgtcgggtcgcc
tatgatctggcctatctcgaccactggagtcttgggcttgatctgtggatcctcgccctg
acgccgctccgcctgatccgcgatcccaacgcctattga

DBGET integrated database retrieval system