KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1486Help
Entry
Rru_A1486         CDS       T00310                                 

Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00052  Galactose metabolism
rru00520  Amino sugar and nucleotide sugar metabolism
rru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rru_A1486
   00520 Amino sugar and nucleotide sugar metabolism
    Rru_A1486
Enzymes [BR:rru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     Rru_A1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 NAD_binding_4 NmrA adh_short Gly_kinase
Motif
Other DBs
NCBI-GeneID: 3834901
NCBI-ProteinID: YP_426574
UniProt: Q2RUA8
Position
complement(1754891..1755856)
Genome map
AA seq 321 aa AA seqDB search
MDGCVLVTGGAGFIGSRVVAGLRAAGSRVAVLDDASAGRPLPARTEGLEVIAGDIRDADL
TGRVVAALRPAAIVHLAALHHIPSCTKDPRRALDINVVGTQSVLDAAAAAGVARVVIASS
GAVYDWGVGALSEESPTSPHDIYALSKLTNEHQLALWARQPGRWARVARLFNVIGPGDPN
GHLIPEVLDRLAGAADTARAADPIVLRLGHLDHRRDYIALEDAAEGLIALLGDGDPAPFS
IDNLCSGRELGVEDLVTRLADLLGLRITCLSDPALRRPNDRPSQLGAPERAWRRLGWRVR
RPVDSALAEIAAADGRFALVS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatggctgcgttctggtgaccggcggcgccggtttcatcggcagtcgggttgtcgcc
ggactgcgggcggcgggaagccgcgtcgccgttcttgacgacgcctcggccggccggccg
ttacccgcccgcaccgaaggactggaggtgatcgccggcgatatccgcgacgccgatctt
acggggcgggtcgtcgccgccctgcgtccggccgccatcgtccatctcgccgcccttcac
cacattccaagctgcaccaaagatccccgccgcgccctcgatatcaacgtcgtcggcacc
cagtcggtgcttgacgcggcggcggcggcgggcgtcgcgcgggtggtcatcgcctcgtcg
ggggcggtttatgactggggcgtcggcgctttgagcgaggaaagcccgacctccccccac
gatatctacgctctgagcaaactgaccaacgagcaccaactggcgctctgggcgcgccag
cccggacgctgggcccgggtggcccggctgttcaacgtcatcggcccaggggatccgaac
ggccatctcatccccgaggttctcgaccgtctggccggcgcggccgacaccgcgcgcgcg
gccgatcccattgtcctgcggcttggccatcttgaccaccgccgcgattatatcgccctg
gaggatgccgccgaggggctgatcgccctgctgggcgatggcgatccggcgccgttttcc
atcgacaatctgtgcagcggccgcgaactcggcgtcgaggatctggtcacccggttggcc
gatctgctgggccttcgcatcacctgcctgtccgatccggccctgcgccgccccaacgac
cgcccctcgcagcttggcgcgccggaacgggcctggcggcgcctggggtggcgggtgcgc
cggccggtggacagcgccttggccgagatcgccgccgccgacggccgcttcgccctggta
tcatga

DBGET integrated database retrieval system