KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1530Help
Entry
Rru_A1530         CDS       T00310                                 

Definition
(RefSeq) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00670  One carbon pool by folate
rru01100  Metabolic pathways
rru01120  Microbial metabolism in diverse environments
rru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rru_A1530
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Rru_A1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR CytB6-F_Fe-S
Motif
Other DBs
NCBI-GeneID: 3834945
NCBI-ProteinID: YP_426617
UniProt: Q2RU65
Position
1800682..1801641
Genome map
AA seq 319 aa AA seqDB search
MTVTASPLIARPRAPRALSVSFEFFPPKTDRMRDQLWDCLRQLEPLEPSFVSVTYGAGGS
TRERTHETVARIAADTTMKPAAHLTCVEATRAEVNAVAQAYWQAGVRHVVALRGDPPTLG
GAYVPHPGGYAYALDLVKGLRDVADFEISVAAYPEVHPQARSAAEDLDNLKRKIDAGATR
AISQYFFDVDSYRRFMDRVLAAGISVPVVPGILPVGNFQTVLKFSNACGTRVPKWMHELF
AGLENDPETHRMVAATLAAEQCLSLFEDGVDCFHFYTLNRADLVRAVCHMLGLRPAAIPT
ASRLAPDQGAGTIALGASV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgacggcttcgccgctgatcgcccgtccgcgcgcccctcgcgccctctcggtg
tcgttcgaattctttccgcccaaaaccgaccgcatgcgcgaccaactgtgggactgcctg
cgccagctcgagccgctggagccgtcctttgtgtcggtgacctatggggcggggggatcg
acgcgcgagcgcacccatgagacggtggcgaggatcgccgccgacaccaccatgaagccg
gccgcccatctgacctgcgtcgaggcgacgcgggccgaggtcaacgcggtggcgcaagcc
tattggcaggccggcgtgcgccatgttgtggcgctgcgtggcgatccgccgacgcttggc
ggcgcctatgttccccatcccggcggctacgcctatgccctggatctggtcaagggcttg
cgcgacgtcgccgatttcgagattagcgtggcggcctatcccgaggttcatccccaggcg
cgcagcgccgccgaggatcttgataacctcaagcgcaagatcgatgccggggcgacgcgg
gcgatcagccagtatttcttcgatgtcgacagctatcgccggttcatggaccgggtgttg
gcggcgggaatcagcgtgccggtggtgcccggcatcttgccggtgggcaatttccaaacg
gtgctgaagttctccaacgcctgcggcacccgggtgccgaaatggatgcacgagctgttc
gccggccttgagaacgacccggaaacccaccgcatggtggcggcgaccctggcggccgaa
cagtgcctgtcgctgttcgaagacggggtcgactgtttccacttttataccctgaaccgt
gccgatctggttcgcgccgtctgtcacatgctgggcctgcgcccggccgccattcccacc
gcctcgcgtctcgcgcccgatcagggcgcggggaccatcgcccttggagcttccgtatga

DBGET integrated database retrieval system