KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1799Help
Entry
Rru_A1799         CDS       T00310                                 

Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
Enzymes [BR:rru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rru_A1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD MTS Methyltransf_18 Methyltransf_23 Methyltransf_24 Methyltransf_11 Methyltransf_12 PrmA Methyltr_RsmB-F Methyltransf_32 Methyltransf_4 CMAS
Motif
Other DBs
NCBI-GeneID: 3835221
NCBI-ProteinID: YP_426886
UniProt: Q2RTE6
Position
complement(2093327..2093977)
Genome map
AA seq 216 aa AA seqDB search
MDYGVARTNMIENQIRTNRVTDPLVIEAMAAVPREIFVPKAFRGVAYVDEDLAIGGGRFL
LEPLNTARLLQVAAIKTSDVVLDIGCASGYSSAVLARMASTVVALECDGELAAKAMANLA
ELGLDNAVVVSGPLRDGYAKQAPYDVIVINGAIPAVPAALKHQLADGGRLVAVVHEKGSG
RVSVTERHGDVFGHRIAFDGNSPLLKDFEETPAFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggactacggcgtcgcacgcacgaacatgatcgagaaccagatacgaaccaaccgggtc
accgatccgctggtcatcgaggcgatggcggcggtgccgcgggagatcttcgttcccaag
gcctttcgcggcgtcgcctatgtcgacgaggatctggcgatcgggggagggcgcttcctg
ctcgaaccccttaataccgcaaggctgctccaggtggcggcgatcaagacatccgacgtg
gttctcgatatcggctgcgccagcgggtattcgtcggccgtgctcgcccgcatggccagc
accgtcgtcgccctggaatgcgacggcgaattggcggccaaggcgatggccaatctcgcc
gagctggggctcgacaacgccgtggtggtcagcggaccgctgcgggacggctatgccaag
caggccccttacgacgtcatcgtcatcaatggcgcgattccggccgttcccgcggcgctg
aagcatcagcttgccgatggcggtcggctggtggcggtggtccatgaaaagggttcgggc
cgggtgagcgtcaccgagcgtcatggcgatgtctttggccatcgcatcgcctttgatgga
aactcgcctttgctcaaggatttcgaagaaacccccgccttcgttttctga

DBGET integrated database retrieval system