KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1889Help
Entry
Rru_A1889         CDS       T00310                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00010  Glycolysis / Gluconeogenesis
rru00051  Fructose and mannose metabolism
rru00562  Inositol phosphate metabolism
rru00710  Carbon fixation in photosynthetic organisms
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
rru01230  Biosynthesis of amino acids
Module
rru_M00002  Glycolysis, core module involving three-carbon compounds
rru_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rru_A1889
   00051 Fructose and mannose metabolism
    Rru_A1889
   00562 Inositol phosphate metabolism
    Rru_A1889
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rru_A1889
Enzymes [BR:rru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rru_A1889
Exosome [BR:rru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rru_A1889
  Exosomal proteins of bladder cancer cells
   Rru_A1889
  Exosomal proteins of melanoma cells
   Rru_A1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Urocanase_N
Motif
Other DBs
NCBI-GeneID: 3835313
NCBI-ProteinID: YP_426976
UniProt: Q2RT56
Position
complement(2188255..2189013)
Genome map
AA seq 252 aa AA seqDB search
MTVRRPLIAGNWKMNGLKAEGQGLARDLAQRLNKAGGVDFDLLLCPPFPLISTVVGAVAG
SGIAVGGQDCHAKAKGAHTGDVSAPMLADLGCQFVIVGHSERRADHGETDALVKAKAEAA
LAAGLIAVICVGETEAQRDAGETLAVVSGQLAGSLPTHADSGKVVIAYEPVWAIGTGRVP
TTEDVAKVHGALRKDLVGALGADGNGVRLLYGGSVKPDNAAELMALENVDGALVGGASLK
AEDFWAIAQSCA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcgtcgtccgcttattgccggaaactggaagatgaacggcctcaaggccgag
ggccagggcctcgcccgggatcttgcccagaggcttaacaaggccggtggggtcgatttc
gaccttcttctttgtccgccttttccgttgatcagcacggtggtcggcgccgtggccgga
tcgggcatcgccgttggcggccaggattgccatgccaaggccaagggcgcccatacgggc
gatgtctcggccccgatgctggccgatctcggctgccagttcgtcatcgtcggccattcg
gaacgccgggccgatcacggcgaaaccgatgccctggtcaaggccaaggccgaggccgcc
ctggccgccggtctgatcgccgtgatctgcgtcggcgagaccgaggcccagcgcgacgcc
ggggaaaccctggccgtggtctcgggccaattggccggatcgttgcccacccacgcggat
tcgggcaaggtggtcatcgcctatgaacccgtctgggccatcggtaccggtcgcgtgccg
acgaccgaggatgtcgccaaggtccatggcgcgctgcgcaaggatctggtcggcgccctg
ggggcggacggcaatggcgtgcgcctgctttacggcggatcggtcaagcccgacaacgcc
gccgagctgatggccttggaaaacgtcgatggcgccctggtcggcggcgccagcctcaag
gccgaggatttctgggcgatcgcccagtcctgcgcttaa

DBGET integrated database retrieval system