KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1998Help
Entry
Rru_A1998         CDS       T00310                                 

Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00630  Glyoxylate and dicarboxylate metabolism
rru00710  Carbon fixation in photosynthetic organisms
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
Module
rru_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rru_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rru_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rru_A1998
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rru_A1998
Enzymes [BR:rru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rru_A1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-GeneID: 3835423
NCBI-ProteinID: YP_427085
UniProt: Q2RSU7
Position
2307874..2308998
Genome map
AA seq 374 aa AA seqDB search
MTDRLRATYRVKATAASIEARAKGIAVEQSVEMPLSAIDDPAVLDGIVGVVEEITERGED
CFEVRLALSTATIGGDAGQLFNMLFGNTSLQDDTVLLDIDLPDDLLASFGGPNIGAAGLR
ARVGASADRALTCSALKPQGLPPDRLADLARRMALGGLDFIKDDHGMADQAYAPFASRVG
AVAAAVDEVNRQTGGQTRYLPSLSGHLDQLRSQVRTGLDHGIDTFLIAPMIVGPSTFHAV
VREFPGAAFFAHPTLAGPSRIAPPAHFGKLFRLLGADAVIFPNSGGRFGYSRDTCQAVAE
AALGPWGGLHASLPVPAGGMSLARVPEMIATYGPDVIVLIGGNLLEARDRLTEETAAFVA
SVAGAASRGCGLAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagactgcgcgcgacctatcgggtaaaggcgacggcggcgtcgatcgaggcc
cgggccaagggaatcgccgttgagcagagcgttgaaatgccgctctcggccatcgatgac
ccggcggttctcgacggcatcgtcggcgtggtcgaggagatcaccgagcgcggcgaggac
tgcttcgaggtgcgactcgccctgtcgaccgccaccatcggcggcgatgccggtcagctt
ttcaacatgctgtttggcaacacctcgctgcaagacgacaccgtcttgcttgatatcgat
ctgcccgacgatcttctggccagcttcggcgggcccaatatcggcgcggccggcctgcgc
gcccgggttggggcttcggccgatcgggcgctgacctgttcggcgctcaagccccaggga
ctgccgcccgaccgtctggccgatctggcgcggcgcatggcgctgggcggcctggatttc
atcaaggacgatcacggcatggccgatcaggcctatgcgcccttcgcctcgcgggtcggc
gcggtggccgcggccgtcgacgaggtcaaccgccagaccggcggccagacccgctacctg
cccagcctgtcgggccaccttgatcagttgcgtagccaagtgcgcaccgggcttgaccat
gggatcgataccttcctgatcgcgccgatgatcgttggcccttcgacctttcacgcggtg
gtccgcgaatttcccggggcggccttcttcgcccatcccaccctggccggaccgtcgcgc
atcgccccgccggcccatttcggcaagctgttccgcctgcttggcgccgatgcggtgatt
tttcccaattcgggcggccgctttggctattcccgcgacacctgccaagcggtggccgag
gcggcgcttggcccctggggcggcctgcatgccagcctgccggtgccggccggcggcatg
agccttgcccgcgttcccgaaatgatcgcgacctatggccccgatgtcatcgtgctgatc
ggtggcaacctgcttgaagcccgcgaccgcctgaccgaagaaaccgccgccttcgtcgcc
tcggtggccggggccgcaagccgaggctgcgggttggcgccgtag

DBGET integrated database retrieval system