KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2034Help
Entry
Rru_A2034         CDS       T00310                                 

Definition
(RefSeq) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
KEGG Orthology (KO) [BR:rru00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Rru_A2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 3835460
NCBI-ProteinID: YP_427121
UniProt: Q2RSR1
Position
2348773..2350269
Genome map
AA seq 498 aa AA seqDB search
MISPSGPKNMKKLHKELKRFSAIEAGLAITGRPAVGIGLAVVFLGVIWAFTAMTFGQTPS
HTFLVLAAVVGGYMALNIGANDVANNMGPAVGSRAMTMAGALLIAAICEASGAILAGGDV
VETISKGIIDPGAMSDNVKFVQVMIAALLASALWVNLATYLNAPVSTTHAIVGGVMGAGA
LAAGVGAVHWSTVGAIVASWVISPMMGGVIAAALLLFVKKMILFQDDKIAAARRWIPVLI
GLMAGAFGMYLLTKGLARVYAPPSWLVGLAGVGSFLGVWALMRPIVRRQTVEMENRRKAV
SGLFTHALIFSSALLSFAHGANDVANAVGPLAAIANALAGGGVEDQAVVLPLWILVVGAA
GISAGLFLFGPKLIRTVGEKITKLDRARAFCVSLSAAVTVLAASGLGLPVSSTHIAVGAV
FGVGFLREALANHQELSHLVHPPRLDAIDNPQRVEKLERRRLVRRQHITTIGAAWVVTVP
LSAALSAGLYLLLTAFLE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgatttccccaagcggtccgaagaatatgaaaaagctccataaggagctcaaacgcttc
tcggcgatcgaagccggtttggcgatcaccggccgaccggcggtcggcatcggtctggct
gtggttttcctgggcgtgatctgggccttcacggcgatgacctttggccaaaccccgtcc
catacctttctcgtcctcgccgccgtcgtcggcggctatatggcgctcaacatcggcgcc
aatgacgtcgccaataatatgggaccggccgtcggctcgcgggcgatgaccatggccggg
gcgctgttgattgccgccatctgcgaagcctcgggggccatcctggccggtggcgacgtg
gtcgagacgatttccaaggggatcatcgatcccggagcgatgtccgataacgtgaaattc
gtccaggtgatgatcgccgcccttctcgcctcggcgctatgggtcaacctcgcgacctat
ctcaacgccccggtctcgaccacccatgccatcgtcggcggggtgatgggcgcgggggcc
ctcgccgccggcgtcggcgcggttcattggagcaccgtcggggcgatcgtcgccagttgg
gtcatctcgccgatgatgggcggcgtcatcgccgccgccctactgctcttcgtcaaaaag
atgatcttgttccaagacgacaagatcgccgccgcccgccgctggatcccggtgctgatc
ggcctgatggccggcgcctttggcatgtatctgctgaccaagggcctcgcccgcgtctat
gcgccgccctcctggctggtcggcctcgccggcgtcggatcgttccttggcgtctgggcg
ctcatgcgtccgatcgttcgccgccagacggtggaaatggagaaccggcgcaaggcggtg
agcggccttttcacccatgccctgatcttttcctcggccctgctgtccttcgcccatggc
gccaatgacgtcgccaatgcggtgggaccgcttgccgccatcgccaatgccctggccggc
ggcggggtggaggaccaagccgtggtcctgccactgtggatcctcgtggtcggcgcggcg
ggcatctcggccgggctgttcctgtttggtccgaagctgatccgcaccgtcggcgaaaaa
atcaccaagctcgaccgcgcccgggccttctgcgtctcgctttcggccgccgtcaccgtt
ctcgccgcctcggggctggggctgccggtcagttcgacccatatcgccgttggcgccgtt
ttcggggtcggcttcctgcgcgaggccctggccaatcaccaggaactgtcccatctggtg
catccgccccggctcgatgcgatcgacaacccgcagcgcgtggaaaagctggaacggcgc
cgtctggtccgccgccagcacatcacgaccattggcgcggcctgggtggtgaccgttccc
ctttcggcggcgctctcggcggggttatacctgctgctcaccgccttcctggagtag

DBGET integrated database retrieval system